SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4IJL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4IJL1
Domain Number 1 Region: 84-453,483-503
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.97e-78
Family Duffy binding domain 0.00032
Further Details:      
 
Domain Number 2 Region: 518-745,796-816
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.8e-35
Family Duffy binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W4IJL1
Sequence length 1324
Comment (tr|W4IJL1|W4IJL1_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW43229.1} KW=Complete proteome OX=1036726 OS=Plasmodium falciparum NF135/5.C10. GN=PFNF135_02144 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MGPPSAVTDYSDAKDFLDQIGQSVHAEVQSDAETYKDELKGSLSHVSTNAETANTADPCT
FEYDKHTTLAKGNTKPCGNEGKEDINRFSDKQGAQCDDKKIEGNKGKESGACAPYRRLSL
CNKNMVKMDTNNNDGKAKHDLLAEVCMAAKFEGESLNTYSAQYDAEYPSGSGHTTCTALA
RSFADIGDIVRGRDLYSGNTKEKEKRKQLDDKLKKIFAKIYEKLEQPAKVYYEDKDTDKN
YYKLREDWWTANRHTVWKAMTCSEKLSNASYFRTTCSDERGGAQANHYCRCNGDKPGEDN
PNTDPPTYFDYVPQYLRWFEEWAEDFCRKKKKYVDIVKTYCRDEKEKYCSLNGYDCTKTK
LAIGKYRMGNQCTKCFFACYPYEKWIDNQRKQFLKQKNKYTDEINGTSRSSRQRRGATTS
NYEGYEKKFYEKLKGNYSEVNKFLEKLSKENVCKRVEDDKGGTINFKNVNSTSGGTAVGA
SGTNDASQGTFYRSDYCQPCPYCGMKKKEPGKEWEKKDENCKNIKLYRPRSGQDGTPINF
LYSGEGETEIKEKLEQFCTKTQNGGGASGDCGGNSDSSLCEPWKCYHVNQLVKDQVGVED
DDDGEYETDVQNAGGLCILKNDQRNEENKAKSQNNHADIQKTFNNFFNFWVAHMLKDSIH
WKKKLEKCLKNGNRIKCGNNKCKDNCGCFLKWVKQKKDEWKPIKEHFYKQEAFKNKGKNG
EGDMLAGLMSCPDFVLQYNLKEEFLKGDSEDASAQDNQNSLNAEELKHIREMLQQAGVAS
DLAAFGGTCTQGPVAEQNTIMDKLLDHEEEIATKCKETHKDDQCKPKAQQENLARAETAT
SPNVQPASEDDDEDLDNEEDDDEDEDEEDQAVDATVNGDGTEVVEETKKSKPPVDLLRVL
NIPKGDYGIPTLKSTNRYIPYGTDRYKGKTYIYMEGDTDEDKYTFMSDTTDITSSSESEY
EEIDINDIYVPGSPKYKTLIEVVLEPSKRDTSNKSSGTKDTQNITTSDTPRNKPINDVEW
NSLKNDFISNILQNSQMDLPQNNISRDTSINIHPDVSILQDSMQEKPFITSIQDRDLHNG
EEVTYNINLDDHKNMNFSTNHDNITPKNNQNDLYTGIDLINDSISGNHNVDIYDELLKRK
ENELFGTNHTKHTTTNSVAKQTHNEPIVNQINLFHKWLDRHKNMCEQWDKNKKEEFLDKL
KKEWNKENNNNSGDINNRYENVLNTDVSIQIDMHNPKPKNEFTNMDTNSDNFIKDTILDD
LDKHPETYFYDIYDDDITYFDTDDVKPPMDDIHIKEQTEMNALHNNKMNELLEKEYPISD
IWNI
Download sequence
Identical sequences W4IJL1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]