SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4IK70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4IK70
Domain Number 1 Region: 320-338,367-441,499-603,664-820
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.7e-75
Family Duffy binding domain 0.0008
Further Details:      
 
Domain Number 2 Region: 825-1043
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.05e-37
Family Duffy binding domain 0.0029
Further Details:      
 
Domain Number 3 Region: 1-170,204-224
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.7e-29
Family Duffy binding domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W4IK70
Sequence length 1266
Comment (tr|W4IK70|W4IK70_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW43500.1} KW=Complete proteome OX=1036726 OS=Plasmodium falciparum NF135/5.C10. GN=PFNF135_02413 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
IKQKIDTFCNKTSDSSGDCGTNIDSSLCEPWKCYKEDDIEKQGDDDPEYHKEVNGSGGIC
ILEKTNGEENGKKQKTFNDFFNFWVGRFLNDSIEWREKFGKCLKNGTKILCKNGCKTLCK
CYESWVEHKQQEWGQIKTHFDKQTLNPEHGGLFKLSPYYVLETVLEDDFLENITKAYGDA
RAIQGIKKTLEKKKKEEQNADTSKEKTIIDYLLEHEGEDAKQCLQTHKEKCDKPPPVIPA
EEGGARSGGPPGGPLPPPGSGPEEQEEEEDEEEEDEVQEEKAEGDQETKVEGPPAQDEVK
PPCKIVDDLFQNPEQFKDVACNQKYGYPQRHWGWKCIPSGDSGVTGTRGNDATTKPGADS
APSGKDTGSICVPPRRRKLYIGRLTQWATNMEATEARGSEPQASEAQTQPQDDTHTQPDP
LLKAFIESAAVETFFLWDRYKKEWEAQKKAEREQSGLPGVGGVPGVLPGAAGGTSLQLLN
GSSLPSESDEDPEKQLKQGTIPDDFLRQMFYTLADYKDILEGKNIVVDMLSASSGSDKEM
AKREEKIKDSIQTFFQNGDTQPSSGKPAPKPGGQTPESWWKENAQHIWKGMVCALTYKDN
TDSGAKDQPPKHLEDVRKAFFGENNTGKPGTPGTYQSTYKYDKVKLDKDSGTEAKSNESP
SPTSDTPTTLDSFIKRPPYFRYLEEWGETFCRQRARMLGKIKYECRTDKVCSGDGEDCND
QLDADPTNVSDLKCPSCATPCRKYRKWIERKKDEFTKQSGAYDGQKTKYEEGSNKDDKGF
CETLTTSPTAADFLQKLKKGPCKNDSEEVKKFFDKNGDTFKHAKDCAPCFEFKVKSEKCN
CGSSAKGNTCTTGKITAKNFENKTDVNEVVMRVSDNAESGFKGDLKSSCENAHIFEGIKE
DKWKCGNFCGYVVCKPEKGNGVTTSGENKDQIITIRGLVAHWVQNFLEDYNKIKHKISHC
KENSEQTICKKDCKDKCKCVDEWINKKRTEWQKIRDRFKEQYKDDPDYNVRSVLEEVIPE
NHLVNVQNKVIKLSKFGNSCGCSAKPSSTNSNEKDAIDCMLKKLEDKAKNCKDQASDTDC
TTPPTTLPDDDEPLEEEDQNPENMRPGFCPQLPDPPQEKVEEKCGKDEETRKEKEKKEQE
EPAAGGKETLVPGPPAPAPADEPFDPTILQTTIPFGVALALGSIAFLFLKKKTQAPVDLL
RVINIPKSDYDIPTKLSPNRYIPYTSGKYRGKRYIYLEGDSGTDSGYTDHYSDITSSSES
ESSTRT
Download sequence
Identical sequences W4IK70

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]