SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4IK87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4IK87
Domain Number 1 Region: 124-300
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.45e-43
Family Glutathione peroxidase-like 0.0000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W4IK87
Sequence length 317
Comment (tr|W4IK87|W4IK87_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW43862.1} KW=Complete proteome OX=1036726 OS=Plasmodium falciparum NF135/5.C10. GN=PFNF135_01796 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MNKVLLNSLNKICNKKKNGYNNFNVLLNIRNIVYDTSRNYKKRENIFYKSFIRNDYSSMS
KKVEDENDNKKKSKKKNIFLTWKCLGINLSLTIPALYLYLYLLQNEKNKKKGFGKTTMES
IGKPLIGGDFTLINHHGNIVTNKSFKNKFCLIYFGFTYCPDICPQELEKQTIVIEKIHKK
YGDIITPIFISVDPQRDTVAQINYYCKSFSPKLIGLTGTKELIKHVAKLFRVYYNENVTD
VNYSKENESISKNNNYNYNYLIDHSIIHYLLDTNGNFLDFFGKNATTSEMVDKISEYIDD
HMNKHKDYPKNTISIQA
Download sequence
Identical sequences A0A024V8X9 A0A024VRX6 A0A024WA19 A0A024WSW3 A0A024XCI8 A0A0L0CZA3 A0A0L7M0B9 Q8IC00 W4IK87 W4J6P0 W7FFS7 W7FYJ2 W7JRT7 W7JXZ5
XP_001349003.1.26446 PFDG_01855T0 5833.PF07_0034-1 PF07_0034 gi|124511740|ref|XP_001349003.1| gi|23498771|emb|CAD50841.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]