SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4IKP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4IKP0
Domain Number 1 Region: 428-738
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.75e-68
Family Duffy binding domain 0.00000000000596
Further Details:      
 
Domain Number 2 Region: 153-404
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.22e-53
Family Duffy binding domain 0.000000000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W4IKP0
Sequence length 1483
Comment (tr|W4IKP0|W4IKP0_PLAFA) Erythrocyte-binding antigen 175 {ECO:0000313|EMBL:ETW43665.1} KW=Complete proteome OX=1036726 OS=Plasmodium falciparum NF135/5.C10. GN=PFNF135_02027 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKCNISIYFFASFFVLYFAKARNEYDIKENEKFLDVYKEKFNELDKKKYGNVQKTDKKIF
TFIENKLDILNNSKFNKRWKSYGTPDNIDKNMSLINKHNNEEMFNNNYQSFLSTSSLIKQ
NKYVPINAVRVSRILSFLDSRINNGRNTSSNNEVLSNCREKRKGMKWDCKKKNDRSNYVC
IPDRRIQLCIVNLSIIKTYTKETMKDHFIEASKKESQLLLKKNDNKYNSKFCNDLKNSFL
DYGHLAMGNDMDFGGYSTKAENKIQEVFKGAHGKISEHEIKNFRKEWWNEFREKLWEAML
SEHKNNINNCKNIPQEELQITQWIKEWHGEFLLERDNRSKLPKSKCKNNTLYEACEKECI
DPCMKYRDWIIRSKFEWHTLSKEYETQNVSKENAENYLIKKKMNDAKVSLLLNNCDAEYS
KYCDCKHTTTLVKSVLNGNDNTIKEKREHIDLDDFSKFGCDKNSVDTNTKVWECKKPYKL
STKDVCVPPRRQELCLGNIDRIYDKNLLMIKEHILAIAIYESRILKRKYKNKDDKEVCKI
INKTFADIRDIIGGTDYWNDLSNRKLVGKINTNSNYVHRNKENDKLFRDAWWKVIKKDVW
NVISWVFKDKTVCKEDDIENIPQFFRWFSEWGDDYCQDKTKMIETLKVECKEKPCEDDNC
KSKCNSYKEWISKKKEEYNKQAKQYQEYQKGNNYKMYSEFKSIKPEVYLKKYSKKCSNLN
FEDEFKEELHSDYKNKCTMCPEVKDVPISIIRNNEQTSQEAVPEESTEIAHRTETRTDER
KNQEPANKDLKNPQQSVGENGTKDLLQEDLGGSRSEDEVTQEFGVNHGIPKGEDQTLGKS
DAIPNIGEPETGISTTEESRHEEGHNKQALSTSVDEPELSDTLQLHEDTKENDKLPLESS
TITSPTESGSSDTEETPSISEGPKGNEQKKRDDDSLSKISVSPENSRPETDAKDTSNLLK
LKGDVDISMPKAVIGSSPNDNINVTEQGDNISGVNSKPLSDDVRPDKNHEEVKEHTSNSD
NVQQSGGIVNMNVEKELKDTLENPSSSLDEGKAHEELSEPNLSSDQDMSNTPGPLDNTSE
ETTERISNNEYKVNEREDERTLTKEYEDIVLKSHMNRESDDGELYDENSDLSTVNDESED
AEAKMKGNDTSEMSHNSSQHIESDQQKNDMKTVGDLGTTHVQNEISVPVTGEIDEKLRES
KESKIHKAEEERLSHTDIHKINPEDRNSNTLHLKDIRNEENERHLTNQNINISQERDLQK
HGFHTMNNLHGDGVSERSQINHSHHGNRQDRGGNSGNVLNMRSNNNNFNNIPSRYNLYDK
KLDLDLYENRNDSTTKELIKKLAEINKCENEISVKYCDHMIHEEIPLKTCTKEKTRNLCC
AVSDYCMSYFTYDSEEYYNCTKREFDDPSYTCFRKEAFSSMPYYAGAGVLFIILVILGAS
QAKYQSSEGVMNENNENNFLFEVTDNLDKLSNMCNTNIKKNNK
Download sequence
Identical sequences W4IKP0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]