SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4IKU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4IKU7
Domain Number 1 Region: 459-559,591-681,735-920
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.93e-75
Family Duffy binding domain 0.00082
Further Details:      
 
Domain Number 2 Region: 137-312,346-366
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.53e-37
Family Duffy binding domain 0.0062
Further Details:      
 
Domain Number 3 Region: 912-1125
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.62e-27
Family Duffy binding domain 0.0038
Further Details:      
 
Weak hits

Sequence:  W4IKU7
Domain Number - Region: 36-112
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.0301
Family Duffy binding domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W4IKU7
Sequence length 1647
Comment (tr|W4IKU7|W4IKU7_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW44291.1} KW=Complete proteome OX=1036726 OS=Plasmodium falciparum NF135/5.C10. GN=PFNF135_01540 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
EKYKSEIKKYTNGQSRGTGGSKRKKRSAHGGSNDNGYEKNFYEKLKEKNKYVKVDGFLEL
LNKEDVCTKKLNDQDEEEGKIDFKNVKSSSASGDGSNKTFYRTTYCEACPWCGAQKKSGG
GWEAKNEDCANEVTKEYNEQDTTTIEILTPEEGQSDILKKYNKFCKNGANGEKSVIDGGQ
IKKWQCYYDKDKPSGQNNNCVQGEWKDFKKGQKVTSYNAFFWDWVHDMLHDSIEWRDEHG
KCINKDNGNTCISGCKKKCDCFQKWVQQKESEWENVKKHFKKQKDIVKEETLLGGVMTHD
FVLEGVLKDGNLLQNIKDVHGDTDDIKHIEELLKDEEATGAIAGGENNTTIDKLLKHEEQ
DAKQCLEKQEECEKKKQQPKPSPARSAEPLEDITHHDSSHEDDEEDSEASDNEEDEDEVE
EEEEAPEGDTTKETTTPQVKPCDIVKDLFENPKTDFKDACTLKYGPKAPTSWKCISDTTT
TSGAPGKSGDTAGSGSICIPPRRRRLYVGKLEEWAEKQVGNTQVAEPQGETSSPSGEKLR
EAFIESAAVETFFLWHEYKKEWESRHATPEVGAGLGLNTDNDDPQNKLKSGNIPIDFLRL
MFYTLGDYRDILFSGSNNNNIVLEASNDKEKMKQLQTKIKEHINSGSTPAPKPNGTTPKD
WWKKYGPDIWEGMICALTYKESDAITGDVTKITQDSGLKNALWDDNTKKPKKEEYQYNSV
TLKEDESGTGPRTTGASIKTEPTKLTDFVKRPPYFRYLEEWGQNFCKERKKRLKEVKKGC
RKNSSDNDTFCSGDGHDCTDGERRYNNMFADLFCRPCYEQCRKYRKWIDLKFDEYHKQEN
KYEEEKQKLNGNSNGNNNCCKEIQNLPSAAEFLKALKHCKNGQNNSEEKGTEEDEKNNKI
NFDKPENTFNPSTYCKACPIYGVNCDARGRSRGRSATNGCTTNNEPENKENTADGQPTTI
PILINDGATDGSTDVTDKQLEEKCKKYGLYKDLRKQVWKCQHINNIYKCELQKQVTSEYY
DHKIPFNILLQRWINDFIQYYNKSKARITRCINDVTLCKQGCKGNCECVQNWLNKKEEEW
NIIKEYYNQNFHSADERIDSRIKSFFEQGTFFSDAKKAQEVVENPDDINKIWGCTGRDDC
TTEETKPDKDFIINLINKLNDKIQFCQTQHGKAQAECDLPPLDDPEPPEEDPDTSTTSVV
PHICEQFVAPEPQPPAPPAQDRTSEDASTEEKEEVPFTPSLPPEDLPPEKNVPVPPPKKP
STPRRRPREVTHSILPEMVSISAFPLSVGIAFAALSYFLLKKKSKSTIDLLRVIDIPKGE
YGIPTSKSKNRYIPYASDRYKGKTYIYMEGDSDSGHYYEDTTDITSSESEYEEFDINDIY
VPGSSKYKTLIEVVLEPSKRDTMNTQNDIPLNDKLDSNKLTDEEWNQLKQDFISNISQNS
QMDLPQNNISRDTSINIHPDVSILHDSMQEKPFITSIHDRDLHNGEEVTYNINLDDHKNM
HFSTNHDNISPKNNKNDLYSGIDLINDSISGNHNVEIYDELLKRKENELFGTNNTKHTTT
NIVAKQTHNDPIVNQINLFHKWLDRHRNMCEQWDKNKKEELLDKLNEEWNKENKNNSNVT
DTNGENNITRVLNSDVSIQIDMNSKPI
Download sequence
Identical sequences W4IKU7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]