SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4INY5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4INY5
Domain Number 1 Region: 196-473
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.75e-48
Family Duffy binding domain 0.00000399
Further Details:      
 
Domain Number 2 Region: 504-782
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.5e-46
Family Duffy binding domain 0.0000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W4INY5
Sequence length 1389
Comment (tr|W4INY5|W4INY5_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW44734.1} KW=Complete proteome OX=1036726 OS=Plasmodium falciparum NF135/5.C10. GN=PFNF135_00946 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MRKTLKLFYISGFLFSSRALCKLENYIKNEYDRENSFYILNNKVEKEYEKGTNNNINIDK
LANGSLEMLEEQLPENNKNFEEKILHEDICKLNKENIEKEGLYKPNTFKSIGNDLLYKKG
KLNFLYEYGMELLHINKVPMNRMNNSRGLGDSNMSFLDISNNNMNSLNSMNNLNNSNNFD
SSNSLSFVDMKSIHRCIKKRAKGERDWACNDKNTKEPNICVSDRRVQLCTGNLIELPIND
STKEKFKEKLILAAQKEGSLLFEKFGKKYNEEFCLNLKWSYGDYGDIIKGTDMEGLGRSI
KVEFEIDRIFKRDNKKSAENRKKWWEEISTHIWNAMIKEHKEKFPKDVKECSADKPLDEP
QINRWLMEWAYDTDYNKNLWYNKLDDSKNKCNRICPKEEICKSECKKYKAWIDKKNNDFT
ILSEIYLKYNKKSSLYKTAFEYLKQKWDKYKELNFSSIFDQLNAKYYNKCICQNNKIENN
ALYVKIEDICNNTKVKSIYGELYCKEKGNDKIWQCINEHIKDFPDVCGPPRRQQLCLGIR
DEGKFLIEKYRKNMHENMYLDERACKYLNYSFDDYKNIILGKDMWRDPNSIKTENILKGN
FEGIKANIVSMYPSYADLSLDEFRKHWWDQNKKQLWEAISCEFYKGNHTGVCLMEDDNDN
QYLHWFREWKNDFCIDKLKWNDVIKEPCIDKKVKSPKPSENPSDVATVCNKSCTDYDKWI
INKRKEYKMQSSKYKRDRSLFNNVIQNLKPWEYLSMKCTECTCNLDTQTFVYPYKGYEDI
CKSTVKPYDPEDIKDEEFNEPSLNVNPLSLTSQDVTERVSSVDDVLSIKENVDLKPFKPK
GGTQSSHVDQVGNPRESESKPSGANGREDPSTESSTYNDGVITSSSSLGSSSGRDVSSSP
VGVGDEHEAKELLPPQKIIDGVTQSDESTLSQHGKESSQEQHNLDGSSLSRHSNQDEEGS
IITSDVAHGTNSLFGGQIQDQETILGESEPLTTSPPEHETSKMDTHAGGKNMEQVRNASV
DSSSEMSNGGRGGLKTKEMKGEEVTGITSKNDINLEDSTVHSRQNKIENSGDNTQGKEHI
NVLQGMDKHLENPPTSERGDSVLESEFSKLNRTSHTHDNNRIETTAENNIGGLSNSNVHD
GRDSQRNRMHINSRSRHGSLESDIVVRGDDISNIEGGEEEEEDANTLKYPRNVLNNKNSR
TYNIEEYIYRDVNKVADDIMRSYKSNRCTNNLSSNYCSKLKKESLSNSCTNEDSKHLCCS
ISDYCMKFFNFNSSGYHSCMRKEFSNHAYKCFAGKGFSNMYYFAGGGLFFIILFLLGAKS
SILNWSEDNELNGTAFEEANFEDAAFEVTTGQDSAFEDYDENAYRIGLLMNQKIQSAKSS
DYLEYHVDN
Download sequence
Identical sequences W4INY5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]