SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4IPL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4IPL7
Domain Number 1 Region: 264-281,320-389,434-531,594-779
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.23e-75
Family Duffy binding domain 0.00096
Further Details:      
 
Domain Number 2 Region: 771-998
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.96e-36
Family Duffy binding domain 0.0043
Further Details:      
 
Domain Number 3 Region: 9-127
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.02e-26
Family Duffy binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W4IPL7
Sequence length 1015
Comment (tr|W4IPL7|W4IPL7_PLAFP) Uncharacterized protein {ECO:0000313|EMBL:ETW51960.1} KW=Complete proteome; Reference proteome OX=57270 OS=Plasmodium falciparum (isolate Palo Alto / Uganda). GN=PFUGPA_06034 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MQNNGSNVEGHPKRMQFVDFFLFWVTHLFNDVIEWRNEISKCITDSSLKKCNNRCNRHCK
CFPKWVKQKQDEWNQIKAHYKHETGFGNANPHDILEYILENNFLDEIKKAYGNEKEIDRI
KNLTRSDPSKTEVKTENDKYAIDVLLKDEEEDAEKCKKCKPPEDKSRGRSDSASPDQQAP
RSKEEKDADSHDDFDEEEDDDEDSHDGDGAEGAEQPEETAEGPAVVDHTGEGPEEEESPP
TDHKLNVCNIVNNILTGNGNLNEACTQKYGPKAPTSWKCIPTNTNDVATISESERAGPAR
KRRDADSGKPTGSSSGDTTGGSICVPPRRRKLYVTPLTKWADTVGNTATQPQGGTSSAGG
KVSSQSDKLRTAFIESAAIETFFLWDRYKKEWKVRRDAELQQENGLVGAAQAPQLQPPGS
VSGEQTPENQLSRGNIPPDFLRLMFYTLADYKDILFSGIKDKKSGYSDIFSGDKDIAERE
KQIKGAIQTFFQNGDSQTPSGKDPESWWQAHGPDIWNGMICALTYKDNDARGTSAKIEQN
SDLKDKLWDEAKKQPKKDEYQYTNVKLKDEPSETQARTGSSTTSQTTQSSPSSDNNPPKL
TEFVEIPTFFRYLHEWGQNFCKERKKRLAQIYKDCQVDENNGPRGAKQNPKCSGYGEDCQ
TNLKNDPSTIPSLECPDCARHCRFYKKWIERKKDEFTQQSNAYDKQKTKYETESNGAKRN
NHDNGFCVTLEKTCDTAAKFLKTLGPCKNENGEDKKGDLYIKFDEDKSFKHTEYCDSCPK
FNVNCKENGNCSKDKRSACKTKNKRHITAEDINGSTEDIGMVVSDDSKSGSGFENGLEPC
KDAHIFKGFRKDVWTCEKVCGYVVCKPIKVNGETTSGEKGNDKHIIQIRALLRLWLEYFL
EDYNKIKHKISHCMKKGEEPKCIKECGKKCNCVEQWIKLKQQEWQQIKNRLLDQYKYEDQ
PDYPVTSFLQELIPQIAVTIDKAEQETLEKLEKSLKCNCTDNSKTKDGNKSYVID
Download sequence
Identical sequences W4IPL7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]