SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4IPU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4IPU5
Domain Number 1 Region: 161-207
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000105
Family Tudor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W4IPU5
Sequence length 315
Comment (tr|W4IPU5|W4IPU5_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW45054.1} KW=Complete proteome OX=1036726 OS=Plasmodium falciparum NF135/5.C10. GN=PFNF135_00655 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MDEFNETLEGLEEKIEEYEKQLALVRDEIKKYEKPEEENEQIKNLKKLEADMIEVINLTR
DLIKYKKQNELENDENKELERSGEVAPDIHEHIKESNKFIGRTCSLNYENKMVYGLIENV
VIHNNIEQLLIHIFETNDRIMIPPNYVQLNEVLNESALKENNQFQALYKKDGQWYDCIIS
KYKGDSFLITYIGYNNSEYVSTDQVRIKKKKKIKEIITPAGYKLPENLIIKEGDSLKVKM
AKKKKRIALKKKQKDEIMDKEFSNKSKQWRSFHEKAISKSKHLLVSTKRVENIENKNNQS
NFNIRRKFDYNDNEE
Download sequence
Identical sequences A0A024WDE3 A0A024WVX6 A0A024XDM6 O97304 W4IPU5 W7FTZ4 W7GCH0 W7K1G0
5833.PFC1050w-1 XP_001351306.1.26446 gi|124505129|ref|XP_001351306.1| gi|4493992|emb|CAB39051.1| PFC1050w

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]