SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4IQA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4IQA2
Domain Number 1 Region: 210-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000209
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W4IQA2
Sequence length 272
Comment (tr|W4IQA2|W4IQA2_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW45315.1} KW=Complete proteome OX=1036726 OS=Plasmodium falciparum NF135/5.C10. GN=PFNF135_00236 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MNILCILSYIYFFVIFYSLNLNNKNENFLVVRRLMNDEKGEGGFTSKNKENGNNNRNNEN
ELKEEGSLPTKMNEKNSNSSDKQPNDISHDESKSNSNNSQNIQKEPEEKENSNPNLDSSE
NSSESATRSVDISEHNSNNPETKEENGEEPLDLEINENAEIGQEPPNRLHFDNVDDEVPH
YSALRYNKVEKNVTDEMLLYNMMSDQNRKSCAINNGGCSDDQICININNIGVKCICKDGY
LLGTKCIILNSYSCHPFFSILIYITLFLLLFV
Download sequence
Identical sequences A0A024WF15 A0A024WX68 A0A024XEL2 A0A0L7K6U0 A0A0L7LWW3 A0A2I0BV63 O76245 Q7KWJ3 W4IQA2 W4J6T0 W7G560 W7JWC3
gi|124800999|ref|XP_001349579.1| gi|3845149|gb|AAC71850.1| PFHG_00789T0 PFDG_00056T0 XP_001349579.1.26446 5833.PFB0305c-1 PFB0305c.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]