SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4IRN0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4IRN0
Domain Number 1 Region: 326-343,382-464,493-594,669-847
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.62e-67
Family Duffy binding domain 0.00064
Further Details:      
 
Domain Number 2 Region: 836-1056
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.96e-29
Family Duffy binding domain 0.0077
Further Details:      
 
Domain Number 3 Region: 24-159,204-224
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.31e-27
Family Duffy binding domain 0.0044
Further Details:      
 
Weak hits

Sequence:  W4IRN0
Domain Number - Region: 1436-1470
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.000112
Family Adhesin YadA, collagen-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W4IRN0
Sequence length 1762
Comment (tr|W4IRN0|W4IRN0_PLAFP) Uncharacterized protein {ECO:0000313|EMBL:ETW51971.1} KW=Complete proteome; Reference proteome OX=57270 OS=Plasmodium falciparum (isolate Palo Alto / Uganda). GN=PFUGPA_06020 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MLISLMIRILHFHVQNIVEHVLSQKNILQKYKKFCENSEKNSQINNWECHYEKNDKGDGN
GDINNCILGEWKTFTGEQDVKSYDVFFYGSIIDMLNESIEWREKLNSCINNKTGKCKYQK
CKEYCECYRRWIDKKKTEWDKIKDHFDTQEGFDILGNNYDWALKMLLNVTFLQDIKDAYP
YEQQLQKIEKLLQNKMQDDFNFERPQTSIDEFLQEEERFAETCKNCQPPTKPASKPEDLA
RSLNPLSPADASPPDPSPPEDGSQSPAQEEEEDEEDLDEVEEEGETHTEDTEGDRQGPKE
GEEPPKVEDICKIVGDALTSGKLDEACTLKYVTGKNYGWKCVSSGGADNSTTKPGSETAH
SRTARSAPETATSSSGKPTSDKGSICVPPRRRKLYVGHLQKWADNSGNDTQVSGETTQGG
AASQAQSSSSSSTTPPSNSRDVGLLAAFVESAAVETFFLWDRYKKLNTKNKGETQGGGNG
DDENNPQDQLQRGDIPEEFKRQMFYTLGDYRDILFSGIKDEKSGDTDIFTGDKDIQERES
KIKEAIKKFFEQTRGGPQPQPNSVTTPKDWWQKNGEHIWEGMVCALTYTEKKDTSEGTNK
IVKDEEVYNKFFGSTPGKPGTTGTSNGTQKGTYKEKYDYNSVKLDNSDTQAKTKDAPNSQ
PPSSSGDDPINNPKLSDFVLRPPYFRYLEEWGQNFCKERKKRLDQIYIECKVGQGRGKKE
NPKCSCYGEDCDDQLDADPTNVSDLKCPSCAISCKSYKKWIKTKKNEFEKQQKAYKEQRT
NYTIKNEGAESTDHDKKFCGTLEENAAEFLQKLGPCSKTNNNVEEDNGEDKTDFRQPEKT
FKEAHNCAPCSEFKIDCKKHRCDSTKGDGCNAKNRITAENIKNCTEDIGMLVSDESTAGF
YDLSVCRGAGIFQGIKENKWECGNFCGYVVCKPKTSDGEKGNENQIIIIRALVKRWLEYF
FKDYNKIRKKLKSCMNSSDATPCIKGCAEEWLKTKKAEWGKIKDRFNEQYKDKDKDKDQE
DYNVKTVLEKFYGRPEFKNAIKPCGDLDQFQNSTDCAVDASSEKENGKKRDVVVCLIEKL
EKEAEKCKEDQKPNGEKQANCGEYTPPDEEDLLLEEEENTVKAPKICENVLKTKTPEEKE
GGCVPATTKPKETSPPADSHPAGPAPGPQSETKSSEEPAKIVPEKKVPAAPSPAPTPRKP
PRPQRTPDLLDNPHVKTALVTSTLAWSVGIGFAAFTYFYLKVNGILLKHGMNSKGIQNGF
YNNKYILSAQKNSAFFSTEKSQDLSSLSKEQIEEKILTVLKKYLPPDVEIKYDEELEKYN
TKDNRAWDFLDTVEFLIDTKQLTILKHVINIPKSDYDIPTKLSPNRYIPYTSGKYRGKRY
IYLEGDSGTDSGYTDHYSDITSSSESEYEEMDINDIYVPGSPKYKTLIEVVLEPSGNNTT
ASGNNTTASGNNTTASGNNTTASGKNTPSDNTPTNKFTDNEWNTLKHDFITNMLQNEPND
VPNDYKSGNSSTNTNITTTSRHNMEEKPFIMSIHDRNLYTGEEIKYNINMSTNSMDDIPI
NRDNNIYSGIDLINDALNGDYDIYDELLKRKENELFGTEHHPKRTTTNHFATPTRDDPIH
NQLELFHKWLDRHRDMCEKWENHHERLAKLKEEWENDTSTSGNTHPSDSNKTLNTDVSIQ
IHMDNPKPINQFTNMDTILEDLEKYKEPYYDVQDDIYYDVHDHDTSTVDSNNMNIPSKVQ
IEMDVNTKLVKEKYPIADVWDI
Download sequence
Identical sequences W4IRN0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]