SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4J0E7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4J0E7
Domain Number 1 Region: 1-17,49-81,118-221,282-465
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.31e-63
Family Duffy binding domain 0.00062
Further Details:      
 
Domain Number 2 Region: 459-674
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.35e-32
Family Duffy binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W4J0E7
Sequence length 859
Comment (tr|W4J0E7|W4J0E7_PLAFP) Uncharacterized protein {ECO:0000313|EMBL:ETW55758.1} KW=Complete proteome; Reference proteome OX=57270 OS=Plasmodium falciparum (isolate Palo Alto / Uganda). GN=PFUGPA_02249 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
RRLYVGKLHDWANSGNTQESGKAAQGEDASQAQSSNVSETPSQSSSSSSSPSSNLRDDAA
LRDAFIESAAVETFFLWHRYKEEKKPPSEQNAGAAQLSPELPGPESDDNNPQTSLQNGKI
PPDFLRQMFYTLGDYRDILYSGGNTSDSGNTNGSNNNNIVFEAGGTQEEKDKMKDIQEQL
KKFFQNSGDKPSTSGNDPQTWWETNGQHIWNGMICALTYDTNSGGEGTPQVDDDVKKELW
DTEKNKPKTKYQYNTVKLDDTSETQAKGGTSQHGQSTSPGTSGDNTPLSKFVLRPPYFRY
LEEWGQNFCKERKKRLEEIKKECTQDNKPCSSYGENCKDQLSDDPSTDADLKCPGCGREC
TKYKKWINTKKTEYEKQKNAYDGQKDKCEKESAGAAPNNDGNGFCKTLDTCTDAAKFLER
LKNGPCKNDNVDDSGKDKTGNSHIKFDDKNKDKTFGPADNCKPCPEFKIDCQKGNCSKDK
EEECKKEKKNSITANDIGDGGNSTVLEMRVSDDSKSGSGFDGLSDCKGAGIFTGIKENKW
KCDKVCGYVVCKPEKGNGETTSGENNDQIITIRGLVEHWVHNFLEDYNRIRKKLKACRNN
GEVSKCIKDCVGKWVEIKKEEWKNIKDHYQKQYGGNDSNNSFSVKTVLEQFEQRTEFQKA
IKPCKSLDQFKTSCGLNSDKPSENGHKNAIDCMLQKLQKKIEECQSKHSGGTQPTCADEP
PLEDEEEEYENENTVGKPAICKDVVDIKTENDETGETCTSEDTITKETVETDSTDGPKQE
EERIAPSAGDDGATPGPQEPTQKSDDKIDQPDKEKETKDNKPPLPPKPLKPAKPKKNKKA
KPVTPPPNLLDHPQVQTAL
Download sequence
Identical sequences W4J0E7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]