SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4J204 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4J204
Domain Number 1 Region: 3-237
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.44e-41
Family Duffy binding domain 0.0000889
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W4J204
Sequence length 3312
Comment (tr|W4J204|W4J204_PLAFP) Uncharacterized protein {ECO:0000313|EMBL:ETW56318.1} KW=Complete proteome; Reference proteome OX=57270 OS=Plasmodium falciparum (isolate Palo Alto / Uganda). GN=PFUGPA_01683 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MSNINNKDSSTEWNCKEDVGCVPPRRQNLNMERLDNENEDSVPDFMKKTFYLAAAGEGKK
LREKHDESCDEFCDAWNRSLADYKDIFQGKDMWNDGKYGEAKNHIKNAFGDMNNRKTMLN
EIEKGIKDETFSRENGLDVCKSQCEERSRDDTEDQFLRFFAEWEEEFCDGLNKHEEQLKS
CTKDINCDIKCSNFKDWLETKKDEYDIQSRVFEKKYANDNKSKHLNYLKEGMNKCKVKNP
EMVFKSGFANVAECRNLNVEGAGNKNSNNLKDLDSNSDKDGIVSESYKATKKNGESIMDR
IPKSFNKLFGYFSGSQEEEQKENDVSHRNNYDNILVDKFHRSSLLDKLDDRMFFDELNRD
NIMEEVLSKIPEPIIREAPKYVPKKPVPPQHIPRGDNVPRNIDVNGSKDEYSPETESANS
KIKPTYEENDEDKSKISIETSEIDRDKEPFRISEEKKVVKEDVQELENIEYEFDETFDFF
DEDAKRNIDDIRKDIQSQIMKSVENYNSEKEEFKRNIETQLIESGDGMNAGNYSSALQDN
STEIPTMVLVPGVLTVFLLTIIWVLVYKHSLIDRVHGTGKTKKEEKMKELESEEFPKEKY
NIEDMEETEKENEIEKIMDENKETEQTEEGNTEEFVQEKELNQETLENEIIVDHIKEEED
TRNVKEQESVLEESPIEELPVENNIGKINEEVEEFILNEIPLEEQVPKELPQEEIEEIVV
EELPIDEHLSSEETTVTEEDTFKGQLINEEKPVEEKIEEKSVSEEIPVEEKSVSEEIPVE
EKNVSEEIPVEEKNVSEEIPVEEKNVSEEIPVEEENVSEEIPEGGIAIEDVPVDEETVTE
EITVDEKIYDKLPNEIETVNEEMPVEDETLTEQISSEHERVPEEIIEEKPFTEGEETESL
TDEIVEEGVVTDDIPEEQIITEKVQEEEEFVTGELSEEDIINEKVQEEESVSEEVLEEEG
STTEEVVEEQGSVTENLLEEESASQGIVEKEEFVDEEDSVKDQNVFEKEGSVTEQLVEEE
KGLINEDNEKEELITEMSEEIKSVNEEIEETDLSTEEIIKQQGLATYEFVEEEKSLTDKL
LEEESVTKEVGETELSTQEVVDEKVSVTEEVIEEEKSVSEEVLEEGSATEEVVEEGSCTE
IVVEKGSDTEIVVEEGSATEIVVEEGSATEVVVEEGSVSEEMLEEEGSATEEVVEEGLSS
DNVQKSKGVIENVGEIYSVKTAKDESMNEKIPLEKSSFVDDESFKGQGPTDNVSVEDVNS
EDIINEHTPLEETKIEELPTEYITTADIHTKGETETKYNLIYEKINEEVEKAKFQEEKIT
ENIPVERESVTEDIVQEPSLAQEVEQKESDTNEIEETKLANEKIIPEVSVTENVVEKEGL
DTEEVLEEDESITEEIVEEEVSACEEIVEEEESSKSSSEEIVEEEESSSEEIIEEVSSTE
EVLEEEGSVTEEIVEEEVSTTEEVKDIGSVSEEVLEEEGFGTEEFVGQQGSVIEEIVETE
SSTEKVLEDVGSNVEEIVQEEGPVAQEIVHEEVSTTEKHDEVDRSTTEEIVEKVGSVSEE
IIVEEVSASEEIVEEGSVTEEVVEEEKLINEVGETESVTEEIVQKEVSDAEEVLGQEGSM
NEEILEKESIVEEIVGPEGSVTEEIVDHGSFAEEVKEEELVTEEAVQYEGSVTEEIKEEE
SITENEAIEESAFAEIIEEKGPNTDEIVKEEGLDTEEIVNEVSVTDEVIEEEKLVNEQIV
GEERSVTEKPVEVERSATEDLVEEEASVTEKVSVHEGSTTEQILDESVAEEIVEEEVSVD
DKIIEEEVSVDEVVEEEGSVIEEIVEEEESVPEEILEEELSGSEEVLEDEWVTDAFMGQE
GSVIEEIEEIVDGEGSITEEIVEDGSANEKIVEEEPSRVEEVLGKEGFVIEEIIEEGSVI
EQVEDTKTVSEKSEESSAIEEVKEVKEEESISEKIVEKEESVTEEIVRQEESTTEKIVKD
VSPTEDFVEQTDSVTEKVIEQEGSNTEVAEDVEEKESASDEHEQEDVSVNAQVTYEKKSV
TKEIVDEVSRTEEIVEENGSVTEGVDETGSVTEEIIEEATVTEEVVEDGSVTEEVVEDGS
VIQEVLEDGSVTEEIVQENGSVTEEIVEEEGSVNEEVEEEVSVSGEEEGSVSEVVDETEV
VNDEIVEQAPFTEEVEEQVSVNDEIIEDASVAEAVEESESITESVSQEEETEKGFVIEKV
EETGAVTEEIVQDGLITEEILEESESVNGEIINKESDAEEILETEFLTEEVVGQAGSTSE
EIVEEEGSVTKEVEEKESVTEELVDEGSVTEELVDEGSVTEEVVEQGGSIAQEIVEEESA
TEEIIRDETNVEEVLEKEGSATEEIVQDGSGTNDFVGKQGSVIEEVVEEEISTTEEKLKE
EASAIEEFVEEESIREDVLEESLVTENVVGQQESVTEEIVDGEGSFTEDIVEEEESVTEE
IVVDEESVTKEIVEDEELVTEEIVEDEGSFTEEIVEDEGSFTEEIVEDEGSFTEEVIEER
SLIEEVEDTETVAEKEEGSVIKEIIDEKSLTEKIVEEEKSVTEEVEEKESVKEEVEEQRL
VVEEEGSATEGIVEDRLATEGIVDDILVTEEIVEDGLATDEFVEHQGSIIEEVLDDEGSV
TEEIVEEEGSPNEEIVEGVSVIEEDDNIEPVSEEIVEGSVTEEMIKEGLENEVILDEDSI
TEEALEKEGSVSEEIVEEMGSLTEEIVDEERSTSEDMIEEGSASEEIIQEESQVEEVVEE
VSVIDEIVEEDELDTKEVVEEIEFNTEEVVEHKEEEGSVAEEIVQEEKEGSVNEEIIEEV
GSITEEMVEQDVSDNEEIVEERSVIEEAEENVWIEKEVEEEGLDNEEVIDEEDSVSEQAE
EEVYINEEILKESSDVEDVKVENELMNEEVNEETQSVAENNEEDKELDNYVVEETESVTE
EVVVDEVPNSKEVQEIESIIEEIVEDGLTTDDLVGQQGSVIEEVVEEVGSDSEEIVEEAS
ITEEVEKKESVTEDILVEESVTGDILVEGSVTEEVVGEEKLVSEEIVTEEGSVAQEIVEE
DAPATEEIDEIESVTEEVVEEEGPVDEEIVQEEGSVTEEIIQGESKVEEVVEEQGSENEE
IFVEEVSASQEIVQNESGTEEILEKVSASQEIVQDGSVTEQIIEEQKPVTEEVVNEEESI
THEIIQEESHVEKVVQQGSVAEEVVENPVSVTEEIVEKEGSVTEDIGQEGYVAEEIVEEE
EFDNEEILEEESVAEEFVEEGFDNEEIFVEQISDSEIVKEENSVNEEVLEEEGSYTEEIL
EEEGSYLLMKKL
Download sequence
Identical sequences W4J204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]