SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4J5D9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4J5D9
Domain Number 1 Region: 90-485
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.19e-77
Family Duffy binding domain 0.0000709
Further Details:      
 
Domain Number 2 Region: 476-658
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.27e-37
Family Duffy binding domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W4J5D9
Sequence length 830
Comment (tr|W4J5D9|W4J5D9_PLAFP) Uncharacterized protein {ECO:0000313|EMBL:ETW57445.1} KW=Complete proteome; Reference proteome OX=57270 OS=Plasmodium falciparum (isolate Palo Alto / Uganda). GN=PFUGPA_00560 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MGRPKRAPTATIDYTNVNNAKDLFDLIGKYIQQKVHGEALEHSKSKLHGLLSQVEFSKNE
KTYVIKACDINKDYETNVTSGHSNPCEDRSKDRFSDTEGAQCDYRKIRGSHKTSNDGACA
PLRRLHLCDQNLEQIEPHQIKNTHNLYVDVLLAAKHEGQMLVNKLQEYDKDNYESRICTA
LARSFADIGDIIRGKDLYRGNKKKNQTETERDKLEGKLQSFFKNIHDNLHDSIKSNYNND
TTNYFQLREDWWDANRLDVWKAITCDAPEDAKYFRDACSEGTTSTHKQCRCATNYVPTYF
DYVPQYLRWFEEWAEDFCRIKRRKLQNLEKECRGQFDDKPRYCSRNGYDCEKTVRARGEL
CMGNRCIDCLYACPRYEKWLANQKQEFLKQKEKYAKEISNSVRKKRSTNNNIYKGYDTQF
YDELQNEYGRVNKFLILLNNETECKGITNKEGKIDFKEDHDKDNNTVKEKGTFYRSDYCE
PCPLCGVQCSGTTCTPHPEDGNCPSIYKIYKPDPNDPSTDITILSSGDGNDDIKKKLDDF
CKKSNNNSLYEKWKCYYKDAQKEACILQTSSDTDVKKQKSYNDFFYYWVAHMLKDSIYWE
TQKLEKCLKNKSKKCGNQQCKDDCECFQRWVGQKKTEWTNIKEHFGKQTDIPPGFPPDAL
LEQVLELEFSNQNTVEDKKNNVSAREIDLINKMLKEDKTTAADGTDSQKKNTIDKLLQHE
LTDAQKCKKTQEECENQKKQKEQPKDMSRALDPPADRRPASPTVEEVAASDEEEEEEQEE
EEDDNDVQDNTVNTAVNGDETEEVVEEEKATTTTQNDVKVCSIVEKILTG
Download sequence
Identical sequences W4J5D9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]