SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4J5G7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4J5G7
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.75e-17
Family Duffy binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W4J5G7
Sequence length 512
Comment (tr|W4J5G7|W4J5G7_PLAFP) Uncharacterized protein {ECO:0000313|EMBL:ETW57513.1} KW=Complete proteome; Reference proteome OX=57270 OS=Plasmodium falciparum (isolate Palo Alto / Uganda). GN=PFUGPA_00417 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MLCQYNGDDKKEHCNEYEEIDKTPQFLRWLEEWARKYCTEKSTRAREINETCEDDIINKI
HTYSIDNIPDEPCKTALTKYRNWYNNNYLHWENLKKKYESNKKNEKEQTTNGAHLSPSTT
TSFYKDDDAEAYVKRKCKECTCNYKDLQEEYKRITEGNNEVSTLIHRARIDSFDLKKRLF
YNILTLGGLVATNVISGLNRTISSFTRDQGQSRDSNSPDQTTQRDDGDEPPLPDGPPGKV
PATDQIKNALLGSAIPLGVGIAFASLAYLLLKVKPKITSTRTNLFRVIDIPQNDYGIPHK
TSINRYVPYSSNLYKEKTYIYIEGEETDDYSYVRVISSSDITSSSEGEYEEMDINDIYPY
KSPTYKTLIEVVLKPSIKNEEAHNTEDAQDILIENMEDTNDTPTNKLTDEEWNKLRNDFI
SQYLKDLPNGMDYQLPNEYTVDDNIYMDIEPNILHDSMDEKPFITQIQDRDLHNGKQITY
DINWNIQKRNEKLLVILQMIRNIFQIMIYILE
Download sequence
Identical sequences A0A024XD32 W4J5G7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]