SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4J6W7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4J6W7
Domain Number 1 Region: 103-479
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.83e-79
Family Duffy binding domain 0.0000993
Further Details:      
 
Domain Number 2 Region: 831-1146,1197-1217
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.66e-75
Family Duffy binding domain 0.0000912
Further Details:      
 
Domain Number 3 Region: 1232-1563
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.36e-71
Family Duffy binding domain 0.00013
Further Details:      
 
Domain Number 4 Region: 2063-2442
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.28e-71
Family Duffy binding domain 0.0000493
Further Details:      
 
Domain Number 5 Region: 2539-2845,2874-2893
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.09e-64
Family Duffy binding domain 0.0001
Further Details:      
 
Domain Number 6 Region: 1588-1797,1826-1937
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.75e-54
Family Duffy binding domain 0.00018
Further Details:      
 
Domain Number 7 Region: 2898-3203
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.15e-51
Family Duffy binding domain 0.00021
Further Details:      
 
Domain Number 8 Region: 470-679
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.23e-31
Family Duffy binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W4J6W7
Sequence length 3671
Comment (tr|W4J6W7|W4J6W7_PLAFP) Uncharacterized protein {ECO:0000313|EMBL:ETW57381.1} KW=Complete proteome; Reference proteome OX=57270 OS=Plasmodium falciparum (isolate Palo Alto / Uganda). GN=PFUGPA_00636 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MGNEQSSSSEGDKIPSIIESQNSARNVLERYAKNIRRHPSKDAKKHVDSLKGDLTKAEFR
GGPSTPVNKHNYYYSYPCNLDHKEHTNLRYDDVNLRHPCHGREQNRFDEDEESECGNKIR
NYKRENDAIACAPPRRRHMCDKNLEALNDINTQNIHDLLGNVLVTAKYEGESIVNNHPHK
GTSDVCTALARSFADIGDIIRGIDMFKPNVHDKVEKGLREVFKKIHDGMEGEVKNYYNPD
GSGNYYKLREAWWNVNRNKVWEAITCGALPKSAYFMQSEDNKQLFSYPKCGHNNKDDPLT
NLDYVPQYLRWFDEWGEEFCRKRNIKLKKVKDSCRNYKERLYCSHNGYDCTTTIWRKGIL
HLDNKCTDCSTKCKVFEVWLGNQQEAFKKQKEKYEKEIQSYLSNDAKFVNNINSEYYKQF
HDQLRDKNYKNLDTFLNLLNEGKYCKEKLKGENDINFTNSSDDKGTFYRSQYCQVCPDCG
VKRDGTKYTHKLDNDRECVNNEDYKPPWGVKPTNITVLYSGNDQGDITQKLEDFCKSSTN
YKDKNNQKWECYYKDENINRCKLEQNTEINNDNPKITSFHNFFELWVTYLLRDTIKWNDK
LKTCINNTTTHCIDECNRNCLCFDRWVKQKEEEWNSIKKLFTKKKNMQQSYYSNINNLFE
GYFFKVMDKLDKNEAKWKELMENIKKKKNEFSNLKNNRDYLENAIELLLDHLKETSTICK
DNNTNEACETSHNATTNPCVKPRGGTQRTKNIKEIAQYFKRSAYEEARNRDLHKLKGKAH
EGLYKRGGKGKDFKDNLCRIMIKHSNRNIGFSNGPCDGKGTGDDIQTRFVVGTEWEVDPE
HMRKDHEDVIIPPRRRHICTSNLEHLQTNISPLNGSDGKLVNNSFLGDVLLSAKYEAKKI
IQMYKEKNNLKGLKEVTDPKHQATICRAIRYSFADIGDIIRGRDLWERNGDMLKLQGHLE
TVFGNIYKSLNGKGNDKYNDDAPKYLKLREDWWEANRAKVWEAMKCKTNGVDITCDSDHT
PLDDYIPQKLRWMTEWAEWYCKVQKKEYDKLKEKCKECKDKDNGQGCTKESGTGCTKCTE
ACNEYNDIIGLWKEQWNIISDKYKELHEQAQMSVSNSGIEASSTAKNHIDRNVIEFLSEL
YQQNGGKSNKSGTSDESAVIGTKTTYDNAGAYLHDTGNFDDCQSQNEFCDEKSDGKDNEK
YAFRDKPQDHDEACGCKSRPKPTRIQKKTKEKEQEKNTECEMVNDILKENDGNEQVGDCH
PKNKSTYPDWQCANTKLVEDPLVCMPPRRQKLCVHFLENNNQIKKLNSQVNLREAFIKSA
AAETFFSWYYYKSKDSKGNELDNTLKAGTIPPEFLRSMFYTFGDYRDFLFGTDISKGHGK
ESALGKKIDSLFKNGDQKPPNGKTRQEWWTEYSHEIWEAMLCALVKIGAKKDYLTENYGY
NNVKFSDKSTTLEKFAKRPQFLRWLTEWYDDYCYTRQKYLKDVQEKCKSNDQLKCDTECN
NKCEDYEKYMKKKKEEWIPQDKYYKDERDKKRFDRQHTGVMVTDYTGTNATDYLNRKFTA
SCGDKPGGSSVVQRNIQLLEKKAYYDADKHCGCTKFIENDDKYINISSKDNCKGLVKEAN
TGAIKWQNKGPNNYNNLKELTEEVLFPSRRLRICFHALDGNYTDPEVKDENGLRKRLMEV
AATEGDNLGQYYKEKNEKEKETKAEADKYSYDVQPCSAMKYSFYDIRDIIIGYDNLEEDK
QDIEKNMKKIFSKNRTSVVKESDSSTGNPGSSVRTEFWNKNKECVWNAMKCGYKRGRDDG
NSGNSARSDEDLKKCGSVPSDDDYPMGKNRDEGTAYQFLRWFTEWGEDFCKHKKKELQKL
VGACNDYTCADNKDKRKKCTDACTQYKKFISEWKPQYEKQIKKYGENNDEIYSENPVAKG
AKDARDYLDKQLQKFCENKSEDCEYRCMKDVSTQSLTDGNSQNMPASLDDEPKEVEGKCN
CQVPTGRPRARRETPSPGAPLTAKATTSEKEAKRAPSTKPPKKVEKPRTEIQSPARKRTR
RAAQQTRTQPVREAPQARTSTSTSTSTSTPPDVATMVKDILSREPDINGGIEKCNPKTYG
TYPKWDCNVGKYKENEKGACMPPRRQKLCINNIQYLNYQTKNKLEKDIKEAFIKCAAIET
YFFWLKYKRENPTAENELKNGRIPDEFKRIMYYTYGDYKDIFFGTDISNENKIITITNSV
TTILKNENNKKQQDKKKKEEELHKKFWEENKKYIWEGMLYGLTHQLEDENEKIKIRDNYQ
YEDMNKLTPSLEDFVKRPQFLRWFTEWAEEFCNKRKEQLKKLEAGCKEYECNGSDDGKTQ
ECAEACVTYQKFIKKWKTEYERQREKFKKDKDGKKYKNYPSTERDIEKATCAHEYLNMKL
KEFCGNKDCSCMEKPSSQLPKITQQSRSSDANDMPESLDYDPEEFNKCECPELSKKGSMI
HTKKIPEPKIPMNCVEKAAYYLSKEAENNLERTLKPKITHSNCVKETDNSFSSNKRCDPN
KPYAPDKYIGRRNPCENREENRFKLDSEWKCYKNIKLYQEKKRVCVPPRRENMCISNLDE
IKIAKVNQSNYLLNMVRIAARNEGIDIIKNFNSENGCAMNPICDTMKYSFADLGDIVRGT
DMLRIGGYLPPLEIKLYKIFEYIYEKWRNKNKGRNKYNDVQTFRSAWWDANRKDIWKAMT
CKAPEDAKLFRKGRMDGFERITLIQDKCGHKDDPPVDDYIPQRFRWMTEWSEYYCKALKE
ELEKLEKSCDHCKTTDKCKNDYDKNKCEKCKTRCQQYDNFVLKWKTLFDIQSKKYKELYE
PIDTKNSTYDYVEKFVQKLKKYKSECSVESVSEYFHETSKCLNYKFDENDGSSNIRSYAF
EETPKSYKEACSCTLPSKNPLDNCPTDKNKDGCKELQTFTFCSKNDYDNNLDNWNAYLVL
NSSDDNKGVLIPPRRRHLCTRPITAYNYRKGDKEILKKKLLTSAFSQGQLLGQKYKSEKE
LCFEAMKYSYADYSDIIKGTDMMDTSLSEKIKKIFETSNEATEDRKTWWENNRRQIWHSM
LCGYKIATSNVTLDEGWCELPKDEETNQFLRWLIEWAKQACKEKKHITNSLKTKCRCSNE
FNFEASELLRQPGCQNDIRKYISLNILIKNSMENLNIKYKQLKDQPSVNIDNKPSEENVQ
SYIKSKYSQCDLELNDINEIDTGTKNNENNELKEVLKKLDTGSCFVENKAHKNHEVHQNK
KEAQADHPNVFFYFPFNLGSFYQAPLFSTHRVAQYDPKNDILKSSISVVIVSALGLIALH
FMKKKFKSSVDLLRILNIPQGEYGMPTLESKNRYIPYRSGPYKGKTYIYMEGDTSGDEDK
YMWDLSSSDITSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSKRDISSDDIPSDDTPS
NDTPRTNRFIDDEWNELKHDFVSQYLPNTEPNNNYKSADIPMNTEPNTLYFDNPEEKPFI
ISIHDRDLYTGKEISYNINMSTNTNNDIPMNARNDSYRGIDLINDSLSGAKPIDIYDEVL
KRKENELFGTKHPKRWKKDNDGGNVPIDNRTLNTDVSIQIDMDHGKPKKEFTNMDTNVDT
PTMDSILYDLERHNEPFYDIYDDDVYYDVNDDNKTSAHHNNLDVSSKVQIEMDVNTKLAK
EKYPISDVWDI
Download sequence
Identical sequences W4J6W7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]