SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4XER3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4XER3
Domain Number 1 Region: 73-176,298-418,476-647
Classification Level Classification E-value
Superfamily L domain-like 2.04e-45
Family Ngr ectodomain-like 0.017
Further Details:      
 
Domain Number 2 Region: 729-886
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.84e-33
Family Toll/Interleukin receptor TIR domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W4XER3
Sequence length 892
Comment (tr|W4XER3|W4XER3_STRPU) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:SPU_001877-tr} KW=Complete proteome; Reference proteome OX=7668 OS=Strongylocentrotus purpuratus (Purple sea urchin). GN= OC=Strongylocentrotus.
Sequence
MAFKHQLLLLHLVISLAQTLLGVATLVPSKSLHLDTSLQGCDKDLERKKMFCGDRGFISV
PQHLPDDTEGLYLEYNTITSLLGSSFRRYPHITDLDLSHNDIKVIESTALHPLKDLTRFD
ISYNFQLVLPGRGFIRWTRKLSHLNVSNSKLTSIPNDILKWSRKLDTVNLRGNLLTAINI
SSCGKAGNVDLSNNMIENLTKYAFNFVCHSDTLDLQGNPIRSVDPSVIASFQVRELKLGW
RVLTIEELRNIFIGMSRSLIEIFTLTNGSDLSVVPKDLFDALRDCSLRILDLSMNQLRAP
YRRVFSKLTSLRQFHLRGNGIVTIEPDFFEGMDNLRVLDLKSNHIKDINTDNVSWTIDLI
ELHLSGNALTTIRESAFRGLHNLTLLDLRSNELLKIVWATSFLELKSIQTIDLSGCMIRP
FQVMIPSSVTSLFLNYMVIPLNFVNLTTSFKHLQLLEHLEMKESDLMNNNLWNPDVNVSL
FDGLFNLKTLDLSINQLYIHLDVKGMLPPWILRQLSTLQYLNLRTCFFSNIHPQAFIALK
SLRVLILSYNQMHQLPVDLFKPLDQVTSIDLANNFLTDLDGAIFLNNPLLETLLLSNNKL
IRLEQNAFKPLYSSLVFIDLSMNPIDCNCDLSWFLDWLNGPLRLTFLEDDFDDDKTICSS
ASLEPLRGKHLIDFDPREFCSINITLVCLPTLAIICLIFIVALVYHYRWPLRYRLFLVKL
AAVGYEEMRDARDHNDYQYDLNVIFYDEDEEWIREHLRPALAERLPQFQRNVFGDEDLVL
GMHYLESVDYVVSHSYKTVVVLSSAAVLDRWFILKFRTAMDHVSDTLTEFVVVVFLEDIP
DDEMPFLARLYLSDGRPYIHWTEDVRGHEYFFDKLTKSLTINLRTNDRIPNV
Download sequence
Identical sequences W4XER3
SPU_001877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]