SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4XJK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4XJK2
Domain Number 1 Region: 79-183,310-428,490-659
Classification Level Classification E-value
Superfamily L domain-like 6.12e-48
Family Ngr ectodomain-like 0.024
Further Details:      
 
Domain Number 2 Region: 731-890
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 7.98e-24
Family Toll/Interleukin receptor TIR domain 0.0027
Further Details:      
 
Weak hits

Sequence:  W4XJK2
Domain Number - Region: 194-323
Classification Level Classification E-value
Superfamily L domain-like 0.000133
Family Ngr ectodomain-like 0.082
Further Details:      
 
Domain Number - Region: 687-745
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 0.0942
Family Neurotransmitter-gated ion-channel transmembrane pore 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W4XJK2
Sequence length 896
Comment (tr|W4XJK2|W4XJK2_STRPU) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:SPU_003578-tr} KW=Complete proteome; Reference proteome OX=7668 OS=Strongylocentrotus purpuratus (Purple sea urchin). GN= OC=Strongylocentrotus.
Sequence
MTWEIIFQLSILLLCSLVMVSSSQEIRAHDEHGITSVAGHVNGTLKSYACYVDFLEKIAD
CKNRQLKDVPNNLINDLRSLDLSSNLIRSLRNTSFLMYSLLEKLNLYNNLIGFIDLATFF
PVDQLTSLSLDHNPIFNLTDIFQESKRLSSLSLQFCNLSYFPNETLGFLPQLQSLDLRGN
ELTYINISKCPKRTLTKLDFSSNKFQEISADVLNFPCRTELLYLGGISFMKIDADVVADF
PILALVFEFLLPGPGQTLQVWKNLFTGIAQSEIDELGLLMAITDVPRDFFDPFRGKRLSY
LLLQQNEFKCYPSIFANLTSVYEMVLETFHIGVLEPAFFDGMKELRSLTASNTKLERVNP
SGSSWKIDLRELNLSENNLRNLGPFAFKGLTNLTSLDLADNAMLTTMATTSLSGLDNLRT
FNVSRTRIVDMTLIYAPLLETFVFTFRPYDRLQKQSALIPGKTFQSTPYLNSIELNNSRV
KLSELWDSSENISLFQGLHNLRYLGLKQNNIGSLPSGVFNNLSALQVLNMSDCQISTIES
GAFASMTSLTILSLQNNDLQILPLHIFDNLIHLSIFSIGNNVLVYIDEALFAKMQMITSI
DLARNQLSTFNQTTFSQISTTLSSIDLSQNPIECSCKSKWLIKLLRGAIDVQNGKDTTCS
FLSMKPFGGEALESIQPNDLCTANFPVYFSAVFFAVIFVIFIIFVYHFRWQLRYKHFLLR
LAILGYREILDKNDREDYDFDVYVISTDDDENWIHDQLKPSFQRFLPYYKRSRNVFTEDD
LPLGMHRTEAVDHVLTRSFKILVLVNKAACADDWFLTCFRMAMDQVADTQTENIIVVFLE
NIEEDEMPLNVRLYMGGQGPYVEWVEDDDEGQKYFWKRLEKCLSVNRKRNHLIPAE
Download sequence
Identical sequences W4XJK2
SPU_003578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]