SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4XLS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4XLS5
Domain Number 1 Region: 91-129
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 2 Region: 58-84
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000471
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W4XLS5
Sequence length 301
Comment (tr|W4XLS5|W4XLS5_STRPU) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:SPU_004355-tr} KW=Complete proteome; Reference proteome OX=7668 OS=Strongylocentrotus purpuratus (Purple sea urchin). GN= OC=Strongylocentrotus.
Sequence
MWMRNSGRSDRKTGALPVGYNCTIDQECLTYESCIKDKHSGWTSCRCTQAPVITSVGTGS
CVVGQSLCDGIPDCSDRSDEIACSSMKPNSQCAIWEFECEDKSCIPRYKCCDLFKDCQKG
EDEINCITQLRDVPEQEPKPAPSPSGGSNLLIITCTVLMTVVIVTLLIYFRRVRSSQRRF
YSPVSWTLNQHGEAISMPYHVSQHANFCHHLPPHRCPRINGLVGYPLSSGEQVPGEPPDV
LLATLEMTGGPRRFTTSRDRSKDNEGDENDIPPTYSEVIKSDADTRRRGGDETPPPSYED
L
Download sequence
Identical sequences W4XLS5
SPU_004355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]