SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4XPV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4XPV3
Domain Number 1 Region: 3-178
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 2.62e-38
Family Nicotinic receptor ligand binding domain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 180-320
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 8.37e-26
Family Neurotransmitter-gated ion-channel transmembrane pore 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W4XPV3
Sequence length 384
Comment (tr|W4XPV3|W4XPV3_STRPU) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:SPU_005440-tr} KW=Complete proteome; Reference proteome OX=7668 OS=Strongylocentrotus purpuratus (Purple sea urchin). GN= OC=Strongylocentrotus.
Sequence
MRMLVDHIADFDEPKQQVTLLCALKVIWRDEYLSWNESDYPEITFLEVDVDLIWSPTITV
LTSNSPDFLQLNHRRVEVSAEGTVTWVSPAIITSTCYFDVLLFPFDVQKCVFEFGPWASP
YNIEELDFFFERNETTVNRYRKNGVWEIVNDTVRKEYTDYSSHEEPFAELHYHITFRRIP
RVYILGIVIPSVLLSISTMLIFLLPPESGEKISFGVTNLLAMVLFQETVRSAMPPTGSPI
LANYICVMMIVACTSLIIEALVLRMYNLGNASDIPRWMQRLFIKKHQTVSLCRRKEPGLH
APLQKGAIIVHHDGSDDPAEHVCEDDQKLQCSDSRNMLDNAELWKMVALSFEEKTAFLTL
CAIAGNIFFTSLYIAILSNIHSRV
Download sequence
Identical sequences W4XPV3
SPU_005440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]