SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4XUZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4XUZ7
Domain Number 1 Region: 116-168
Classification Level Classification E-value
Superfamily RING/U-box 4.71e-18
Family ZZ domain 0.008
Further Details:      
 
Domain Number 2 Region: 357-405
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000219
Family UBA domain 0.0041
Further Details:      
 
Domain Number 3 Region: 16-89
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000932
Family PB1 domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W4XUZ7
Sequence length 414
Comment (tr|W4XUZ7|W4XUZ7_STRPU) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:SPU_007251-tr} KW=Complete proteome; Reference proteome OX=7668 OS=Strongylocentrotus purpuratus (Purple sea urchin). GN= OC=Strongylocentrotus.
Sequence
MSMTVKAYLKRGENANAEIRRFVIDVAVSSNYEYLSKKVAQVFPSLGDPDYFSLSWKDSE
GDNITFSSDDELVEALGQINDDTFRIYVKEKKRCRREIRDAPSPGTSTDDGAGQEEQAYH
PGVICDGCESRIRGPRFKCITCPDYDLCKQCESRGIHPDHSFVKFRKPQVGRSHHGGFFN
RPGMFRPFGHPGWRHWWRHQQQQQQQGAGIDVDIDIDNQGNRTHCAGEPNFCGGGGGGHG
RGKHGRRHGGKGHRGCRKTWAGCEQGSSMDVGQEAEPAPSGAARSQEKSGEAGGNTQNKE
QDATQKQPEGTAEPMETTVKDGSAAAPNQSPSGSDDADWTLLENAGGKPSAPSQNPQEDP
SYQYQTALNQMGAMGFDNEGGWLTSLLDAKGGDIVRVLDAIKIGNQPSFSGNSK
Download sequence
Identical sequences W4XUZ7
SPU_007251 7668.XP_795534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]