SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4Y123 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4Y123
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.79e-45
Family PB1 domain 0.0000644
Further Details:      
 
Domain Number 2 Region: 139-204
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000416
Family Protein kinases, catalytic subunit 0.0036
Further Details:      
 
Domain Number 3 Region: 233-297
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000568
Family Protein kinases, catalytic subunit 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W4Y123
Sequence length 309
Comment (tr|W4Y123|W4Y123_STRPU) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:SPU_009398-tr} KW=Complete proteome; Reference proteome OX=7668 OS=Strongylocentrotus purpuratus (Purple sea urchin). GN= OC=Strongylocentrotus.
Sequence
MAAQPLVIRIKTQHGEDVDWTVQLGQLSFHEVLEVIAQVLQDNTPAAFEYEDEDGDRITV
RSDDEMEAMINYYLSLLAECEARRVMAPPLNIYPQVKPGGRKNIHNLTVNTRPAGAVPKG
ADSGISLGYGRHDAELREILASGRIVETDILHLEVLGRGHSGQVYKAKHVPTNNVMAVKV
IPLDITPEAQKEILSELQILYKVNTRPAGAVPKGADSGISLGYGRHDAELREILASGRIV
ETDILHLEVLGRGHSGQVYKAKHVPTNNVMAVKVIPLDITPEAQKEILSELQILYKLCTE
TTRFPLLMG
Download sequence
Identical sequences W4Y123
SPU_009398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]