SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4YDT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4YDT5
Domain Number 1 Region: 79-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000812
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 2 Region: 40-77
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000942
Family LDL receptor-like module 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W4YDT5
Sequence length 154
Comment (tr|W4YDT5|W4YDT5_STRPU) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:SPU_013914-tr} KW=Complete proteome; Reference proteome OX=7668 OS=Strongylocentrotus purpuratus (Purple sea urchin). GN= OC=Strongylocentrotus.
Sequence
MGPARCGREGISLTSAITVRAVCMGLGRAVSPQDCISSANHTCTGDMFRCTNQRRCISRS
WVCDGDNDCGDAQDEHSSLGCNVTRCKDGEFACANGRCIQQSWACDHDDDCGDGSDEPKD
SCVRETVLELLLRVRILEYSTTRRSLNSYAIQLQ
Download sequence
Identical sequences W4YDT5
SPU_013914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]