SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4YJL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4YJL6
Domain Number 1 Region: 159-292
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.61e-23
Family Ricin B-like 0.0085
Further Details:      
 
Domain Number 2 Region: 6-104
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.000000000000166
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000283
Further Details:      
 
Domain Number 3 Region: 106-163
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.0000416
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W4YJL6
Sequence length 306
Comment (tr|W4YJL6|W4YJL6_STRPU) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:SPU_015980-tr} KW=Complete proteome; Reference proteome OX=7668 OS=Strongylocentrotus purpuratus (Purple sea urchin). GN= OC=Strongylocentrotus.
Sequence
MGRQKISFRVWQCGGSLEIIPCSRVGHVFRKKHPYTFPDGNANTYIRNTRRAAEVWMDEF
KVLFYNARPSARGKFYGDVSERKELRKQLKCQSFKWYLTNVYPELKNTRRAAEVWMDEFK
VLFYNARPSARGKFYGDVSERKELRKQLKCQSFKWYLTNVYPELKIPGPNELVYGQIKQG
NTCLDSSPHPTGSAWPPVMARCSKKQKHQSWIITKDDTVEQDATCLTVTSTHVDSRVYIS
SCLPNDIKQKWTRVDNSLQHTLSKLCLDNQIPDKGLIVKQCNSKSKTQSWFILPSSTLIR
GDHSLR
Download sequence
Identical sequences W4YJL6
SPU_015980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]