SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4YVR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4YVR3
Domain Number 1 Region: 31-461
Classification Level Classification E-value
Superfamily Sema domain 1.09e-61
Family Sema domain 0.0017
Further Details:      
 
Domain Number 2 Region: 468-518
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000746
Family Plexin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W4YVR3
Sequence length 549
Comment (tr|W4YVR3|W4YVR3_STRPU) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:SPU_019919-tr} KW=Complete proteome; Reference proteome OX=7668 OS=Strongylocentrotus purpuratus (Purple sea urchin). GN= OC=Strongylocentrotus.
Sequence
MDRKKMGELLLFLILISCQTRSIQSAPLSSYLVSSFTPPGSDSTLPFNHIAINNITGDVY
IGARERLYQLDSDLNLKHTVNTEKCTDLDAGNVNDNKLLIVVTTPQKNTLLTCGGCDGYC
ESRSLTNISHDVMRYSKTSSQEVVTIGDVPTVGAVVLGSDFVDNGESTPNETFSLFTGVT
FKGRGTAQFISKHNLIDLSLVQNIQRGYVKSESLFKHLIVYKDYLYYFISRGNIVYLGRL
CRNSLDIELASYTEIELQCGSYNMIQSAHIGPAGSELGDSLNIDTTDALLYAVFSNESSS
FLCVYKMSDVQHSFESAVFGCIQGTSTGTINSNLLDTMCRSAPLLTLPDTVLCTAYYKED
NIPVPLYQYASGTVPIFASPIVTITDAIPTSIVATIERHHTVAFIGDTQGKLHKLNIVNG
SFGYVYENVSLGGGSVLQEVFLDESKEQLTLSTSSDQVSKVLTLDFVNCGQYQSCGECIG
EKGGNDGDPYCGWCTLDARCTRYEECPFPDESTRWLSYNALQCVSISDVHPDHRLPSQVT
EQEVGAIGT
Download sequence
Identical sequences W4YVR3
SPU_019919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]