SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5E1D3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5E1D3
Domain Number 1 Region: 24-121
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.09e-28
Family Chaperone J-domain 0.00024
Further Details:      
 
Domain Number 2 Region: 199-309
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000888
Family Calsequestrin 0.082
Further Details:      
 
Domain Number 3 Region: 444-566
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000492
Family Calsequestrin 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5E1D3
Sequence length 576
Comment (tr|W5E1D3|W5E1D3_WHEAT) Uncharacterized protein {ECO:0000313|EnsemblPlants:TRIAE_CS42_4BL_TGACv1_321796_AA1065580.1} KW=Complete proteome; Reference proteome OX=4565 OS=Triticum aestivum (Wheat). GN= OC=Pooideae; Triticodae; Triticeae; Triticinae; Triticum.
Sequence
MGIPIRSLLVASLVLSSIALHVAAKTLDPYKVLGVDKNASQRDIKKAFHKLSLKYHPDKN
KEKGAQQKFEEINNAHEILSDEEKRKNYDLYGDEKGNPGMGAGNFGSHDFTGGGPRTTYF
SSGDGWQTMGGQGNSKTFSFSFGGNPGAGGGNPFGFDLGDVFSNMFAGGSMGGSQHGGFA
GSGRPSARTSSQHTNPVTIQEVTMQTFNKEIADQGITWLLLFYTQQAKGQFVLESVLEDV
ARSLDGAVRAGKVNCDNEKALCKKNGVSVGKSARLFIYSYSTAEKGSLHEYSGDSDAKSL
KTFCQEHLPRFSRRVDITQFNFPSSALPNLPEVLLLSTKKDTPAMWRAVSGMFHSRLIFY
DAEVQDVSLPLLKRLGVKNVPALVGRTVNGEVQLLKDGISVKDLQSGIKELKTLLESFEK
KNKKLASEQAKKPAKASEPKENKIPLLTASNFEETCGEKAPVCIIGVFKSNKAKEKLESI
LSEISQKTLIRGQSYNSGNAITYALLDGNKQSAFLSSFDKSGYKSSDKLLIAYKPRRGRF
AVYKGEVSMEEAERFVVSVLNGDVQLSATGEKPVLR
Download sequence
Identical sequences A0A1X9IGT2 W5E1D3
Traes_4BL_0F8D63879.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]