SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W5GBM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5GBM7
Domain Number 1 Region: 348-383
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000051
Family Rho termination factor, N-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5GBM7
Sequence length 387
Comment (tr|W5GBM7|W5GBM7_WHEAT) Uncharacterized protein {ECO:0000313|EnsemblPlants:TRIAE_CS42_6AL_TGACv1_472779_AA1525900.1} KW=Complete proteome; Reference proteome OX=4565 OS=Triticum aestivum (Wheat). GN=4331846 OC=Pooideae; Triticodae; Triticeae; Triticinae; Triticum.
Sequence
MTGAAPALLHHHGVSSRGTLPVYHGNCRFVPGSCFLSKSTILGPLTVSLVCGASPNNHRP
RNPDISRQQKRGSSSRGKSKPFQERDDSENNDEFDSDTVSSKNGPPMSLTSNSRPHATSA
PGEREKEIVELFKRVQAQLRARGKGREDKKPEPAKSQGEKGSVDSLLNLLRRHSVDQKRK
SSDEKEQNFDQTWRSSDSGNKQSSRIFGTKNDVQEGQKPPPATFQRPPSSFRRRSPVPGV
KFQLVTNPEAGAKPVVNGMTDAVLKAKTPLEEETAQDEPDSVSPYEPDSVLAPEDASLDD
FVVSDDESDVLDADEPEDYLEPLDDVDDIPDSSASLDDSLEGSPSAEASDLSSLKVTELR
ELAKSRGLRGYSKMKKGDLVALLSDAS
Download sequence
Identical sequences W5GBM7
Traes_6AL_FFC054BE1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]