SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5KJU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5KJU8
Domain Number 1 Region: 26-138
Classification Level Classification E-value
Superfamily PH domain-like 5.38e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000277
Further Details:      
 
Domain Number 2 Region: 232-300,359-376
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.05e-23
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000433
Further Details:      
 
Domain Number 3 Region: 415-476
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000000262
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5KJU8
Sequence length 487
Comment (tr|W5KJU8|W5KJU8_ASTMX) Wiskott-Aldrich syndrome (eczema-thrombocytopenia) b {ECO:0000313|Ensembl:ENSAMXP00000007860} KW=Complete proteome; Reference proteome OX=7994 OS=Astyanax mexicanus (Blind cave fish) (Astyanax fasciatus mexicanus). GN= OC=Astyanax.
Sequence
MSKGKVKGQENMTSSLLNIQENERLVDLLGRRCVSLATAVVQLYMALPHSPAHWSLQHTG
VVCFVKDNPRRSYFIRLYDLKDEKMIWEQELYNQMTYSSPKQYFHTFCADDCQVGLNFAS
EQESDAFRNTVEDKISQRSNRQDKRPASNEEKRAPPPLPPSNGPGPGPGPGQAMQPGGMS
TVDIANPDILPSRYRSPTVPVPAPASLGKGKKDKKGKKKGPRLTKADIGAPSGFKHISHV
GWDPNAGFDTNNLDPDLKKFFSYAGISEDQLTDKETSKVIYDFIEQSGGLDAVKEEMRKQ
DALGPPCRGLPPVPGAPVPPPPRGSLPSIPGQPPPAPPSRNQRTPQRGAVPPPPPGGRAV
PPPPPPPSGGYGSPPPPPSGGAPPPPPPPPPPPPSSASSYSSGSPVSPSAPSPSGGRGAL
LDQIRLGTKLKTVTESSDLPPPPQDEGGEGLVGALMMVMQKRSKVIHSSDDEEEDGGDDE
DDDEWDD
Download sequence
Identical sequences W5KJU8
XP_007231962.1.101067 ENSAMXP00000007860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]