SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5KM34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5KM34
Domain Number 1 Region: 24-115
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.58e-31
Family Ras-binding domain, RBD 0.00022
Further Details:      
 
Domain Number 2 Region: 336-446
Classification Level Classification E-value
Superfamily SH2 domain 4.71e-31
Family SH2 domain 0.00000427
Further Details:      
 
Domain Number 3 Region: 146-259
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000017
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5KM34
Sequence length 449
Comment (tr|W5KM34|W5KM34_ASTMX) Uncharacterized protein {ECO:0000313|Ensembl:ENSAMXP00000008646} KW=Complete proteome; Reference proteome OX=7994 OS=Astyanax mexicanus (Blind cave fish) (Astyanax fasciatus mexicanus). GN= OC=Astyanax.
Sequence
MLCTQPYLSCRASPKSQLCLPPNTGVIKVYTEDNSSRAVEVPSDITARDICQLFVLKNHC
IDDHSWTLFEHLAHLGIERTIEDHESVLEVQSNWGMDSDSRLYFRKNYAKYEFFKKPLDF
FPENMVSISSEANGLMNHSELIQTFLNSSTCPEIHGFLHSKEQGRKSWKKFYFVLRRSGL
YFSNKGTSKEPRHLQFAAEFCDGDVYTLLSARKTHGAPTDYGFCVKPSKSSSARDLKLLC
ADDEQTRTCWITAMRLFKFGMQLYQNFIQPHQKQKNSPMRSISENSLVAMDFSGHRSRVI
ENPSEALSVAVEEGLSWRRKSCHRLSHGSCSPSQSSLSNIAIHMAQPWFHSKLSRDEAQK
LITQHGLIDGVFLLRDSQSNPKTFVLSLCHTQRIRHFQILPVEDDGELFYSLDDGNTRFT
DLLQLVEFYQLNRGVLPCKLKHHCARTTL
Download sequence
Identical sequences W5KM34
ENSAMXP00000008646 XP_007261098.1.101067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]