SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5L0G8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5L0G8
Domain Number 1 Region: 100-137
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000432
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 2 Region: 42-90
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000405
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 3 Region: 502-543
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000105
Family EGF-type module 0.023
Further Details:      
 
Domain Number 4 Region: 556-598
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000222
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5L0G8
Sequence length 598
Comment (tr|W5L0G8|W5L0G8_ASTMX) Complement component 9 {ECO:0000313|Ensembl:ENSAMXP00000013330} KW=Complete proteome; Reference proteome OX=7994 OS=Astyanax mexicanus (Blind cave fish) (Astyanax fasciatus mexicanus). GN= OC=Astyanax.
Sequence
TMRTLTVVLLVFCFQQSIGMSVGGNRQGSRREVREVDAPAPIDCKMSAWSAWAECDPCTK
TMRRSRGIETFGQFGGRKCIEPIGEKKPCVPTTECQQDPPPVCKSTEFQCESGVCIKQRL
VCNGDNDCGDFSDEEECEKIRAPCGNTPVTESDIGRAAGYGINILGSGPRMNPFNNKVYN
GMCERVKDPSTLQYNRLPWNVAVLNFEKTLVEESSSKEMYEDTHSLIKELTEEVTSKTSL
GLSFKFTPTENLNDSFSVSTGFNTATDNSNIVKTITEDKTIKGKTFLRMKGKVQLGTYRL
RTRNLEVSETFLDDVDALPIKYEKGQYFGFMEDYGTHYTKNGRSGGEYDLVYVLNSEIMS
KKRVKETTVKGCLKIGFNANFQIINATLGQFDPGVQSTPKDDCKVMTEKDEGSGENKAII
DKVISSVKGGSPQSAAALKSQLSKEGMLDWQHFAEWARSIGDLPALIYSEPEPIYNAIPL
TFPDALPRRENLQRALHEYMAEYSVCKCQPCKNGGTVAQVDGQCVCLCPVQFEGIACQIL
RHELMKDNSKPVQQEGNWACWSAWSSCSGGRRTRKRSCNAGTTAGATCKGDTVSEDYC
Download sequence
Identical sequences W5L0G8
ENSAMXP00000013330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]