SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5L1A3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5L1A3
Domain Number 1 Region: 349-487
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-39
Family C-type lectin domain 0.00041
Further Details:      
 
Domain Number 2 Region: 499-634
Classification Level Classification E-value
Superfamily C-type lectin-like 1.82e-34
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 3 Region: 1089-1220
Classification Level Classification E-value
Superfamily C-type lectin-like 1.59e-33
Family C-type lectin domain 0.00054
Further Details:      
 
Domain Number 4 Region: 222-354
Classification Level Classification E-value
Superfamily C-type lectin-like 1.44e-31
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 5 Region: 799-927
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-31
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 6 Region: 934-1079
Classification Level Classification E-value
Superfamily C-type lectin-like 1.38e-30
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 7 Region: 1217-1368
Classification Level Classification E-value
Superfamily C-type lectin-like 9.78e-29
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 8 Region: 634-777
Classification Level Classification E-value
Superfamily C-type lectin-like 4.02e-27
Family C-type lectin domain 0.0001
Further Details:      
 
Domain Number 9 Region: 31-157
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.84e-23
Family Cysteine rich domain 0.00078
Further Details:      
 
Domain Number 10 Region: 156-214
Classification Level Classification E-value
Superfamily Kringle-like 4e-17
Family Fibronectin type II module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5L1A3
Sequence length 1457
Comment (tr|W5L1A3|W5L1A3_ASTMX) Mannose receptor, C type 1b {ECO:0000313|Ensembl:ENSAMXP00000013615} KW=Complete proteome; Reference proteome OX=7994 OS=Astyanax mexicanus (Blind cave fish) (Astyanax fasciatus mexicanus). GN= OC=Astyanax.
Sequence
SRAFDVAFNVVVLLLVMLIYLHGQSDYFDWTFLIYNAHKNRCLGSNLQRLDVCDPHSPRQ
QFRWTSENSIFNIAEKKCLGTGSISEGNKLQWYTCDATSALQKWECQTNLKFSVKNESLY
LSLQGDSYLLTLSRDPGEKGKWTLHGTMDSICSRPYEEMYTIKGNALGRPCQFPFRYKNN
WYADCTKEDSAKKRLWCAIESVYEVNELWGYCPTREKVDDFWKKNPLTNVYYQVNGQSAL
TWYQARKSCQQQGGDLLSITEPHEQTFISGLIQQAGSVFWTGLNSLDASRGWHWVNAQPL
RYLKWGKGQPSSLPGHSCGVLDQSHDSGWSTAVCSEKHGYICQRGLIIPTVPPVVHTGSC
HSPWIPYSGHCYLLSRTKRTWLEAKDSCRREGGDLLSILNVEEQSFTISQLGYAKTDELW
IGLNDLKTSMLFEWSDHSNIQFALWDVNEPSHNAALKENCVLMKEEEGKWADQICQKKYG
YICKKKSHLQPSTNDTAVTNPGCKAGWVRYGYYCFLAGSETKTFEEARKMCEKAGSYLVD
ITNRIENAFLVSLIGARPEKHFWIGLSNMKDKHTFEWTNTTKVQFTHFNAGMPGGRQGCV
AMTTGVLAGLWDVLSCTNTEKYICKQKAEGLITTMAPPTTPAPSCNESWSPIPNRDFCYK
LFSVEQSQWKTWYEALDYCRDLGGDLLSIHGTFYIEAEGLSSSTAWIGYSIQDPSVGFTW
SDGSSSSYENWQEGEPNNLNNAEQCVTVLFHWWRSTELEWNDLHCQDKCNWLCEIRKGKT
SSQTLPSSMQDLAYNTTEDGWIIFKDNQYYFSDEASSMESARRFCKHRHGDLVSINDEEE
RVFVWHQTKTLHYADPYIGMRIDMDKSLTWMDGSPVVFQAWASQQPAFLNEDEHCVKITW
SQGLWESINCGDLEKFICKRSGSVPVNSTVAPTEPPTGGCAAEWMKFQDKCYKLNLEKKT
WLDARSSCKQLGGNLASVTNSLLQATLTLKMAEDNSPDLWLGLSNLAGYFKWTDGSSFTF
IAWRQGNPGRKPVGSCKNLSTSLWEPRCATIGGKQSSKPGKWLQNDCNDTNGYICSRALD
SDHLIKPTPTELPKTFIKLGNSSYMLVQTNMTWKEAQSHCQSVGANLVSIQDVFTQSYIH
LQAHKVGRPLWIGLNSMETDGYFLWIDNWQLYIQNWDYGEPKKDHPCVYVDTDGNWKSAK
CNQTYYSVCKKSSEIAPTPPAQFPGMCPEETEDEPTMTWLPFRGHCYAFVTNFHSWVAAS
NVCNRKGGSLASIQDTKEAKFIENYISLLGNNQEKFWIGLFKTFAGHWLWVDKSVVDYTN
WEQSNNDEEEEDDGYEGKNCAFISAESKQWKQNHCVYSYAMSICKIAKVMHSTTAPNQTV
IFSDLTAGPDTHRTHSAVVSVVVVILVVSVLAGLAYVYYRTSKRRFVLPAVVNPLYYTTE
VSQPEDKDTKTLVDHMQ
Download sequence
Identical sequences W5L1A3
ENSAMXP00000013615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]