SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5LW43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5LW43
Domain Number 1 Region: 94-189
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-30
Family PDZ domain 0.013
Further Details:      
 
Domain Number 2 Region: 16-71
Classification Level Classification E-value
Superfamily L27 domain 1.12e-25
Family L27 domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5LW43
Sequence length 205
Comment (tr|W5LW43|W5LW43_LEPOC) Protein lin-7 homolog {ECO:0000256|PIRNR:PIRNR038039} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
LTDFRHKMAAIGEPVRLERDISRAIELLDKLQRTGEVPPQKLQALQRVLQSEFCNAVREV
YEHVYETVDINSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQ
NSPIYISRIIPGGIADRQGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGAVKLVVRY
TPKVLEEMESRFEKMRSAKRRQQNS
Download sequence
Identical sequences W5LW43
ENSLOCP00000000350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]