SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5LZE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5LZE6
Domain Number 1 Region: 76-185
Classification Level Classification E-value
Superfamily TRAF domain-like 3.07e-17
Family SIAH, seven in absentia homolog 0.0061
Further Details:      
 
Domain Number 2 Region: 9-81
Classification Level Classification E-value
Superfamily RING/U-box 5.61e-17
Family RING finger domain, C3HC4 0.0066
Further Details:      
 
Domain Number 3 Region: 244-301
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000276
Family PDZ domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5LZE6
Sequence length 329
Comment (tr|W5LZE6|W5LZE6_LEPOC) Uncharacterized protein {ECO:0000313|Ensembl:ENSLOCP00000001503} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
MGLDVELFVDSVDPDFRCRLCTKVLEDPMSTPCGHVFCAGCILPWSVKQRQCPLYCKPIS
AKELHQVLPLKNLIEKLIIRCLYHSRGCIKKVKVQDLGYHTEMCDYSPSRCRNKGCNEVL
SLKDMDTHMRESCDCRPVEMCQNGCGLLLLHKDIVHGNHCCLNALRAQSGALQVKSANVE
QAAKRQGIRLARRENSLLARVSALQNEVHLTALTYQMRFNRYKIYINNLSKHVTGRCKGG
ELQRLSIALHREKDSLGFNIIGGILLQEESTPEGIYVSKILERAPADKAGLQLHDQIIEV
GPSLPCCNCTNSSSCLLTVDVSKFTLVLV
Download sequence
Identical sequences W5LZE6
ENSLOCP00000001503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]