SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5M1A3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5M1A3
Domain Number 1 Region: 72-251
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.02e-50
Family Ypt/Rab-GAP domain of gyp1p 0.006
Further Details:      
 
Domain Number 2 Region: 226-338
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.89e-30
Family Ypt/Rab-GAP domain of gyp1p 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5M1A3
Sequence length 647
Comment (tr|W5M1A3|W5M1A3_LEPOC) Si:ch211-288d18.1 {ECO:0000313|Ensembl:ENSLOCP00000002160} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
MKKDIETLIAEERAEIISKYDKGRHEGVEIDPWEDADFNIYKVTDRFGFLHEEELPTPSA
LEEKQKQQEIERVDKWLKMLKKWDKYRNSEKMLRRVYKGIPLHLRGQVWSVLLEVEKLKN
ENVGKYEKMKEQARSYSTEIKQIDLDVNRTFRNHIMFRDRFDVKQQALFHVLAAYSVYNT
EVSYCQGMSQIAAILLMYMNEEDAFWALSQLLTNQKHAMHGFFIPGFPKLQRFQVHHDQI
LSKLIPKLKKHLDKEQMSTGIYTTKWFLQCFIDRTPFTLTLRLWDIYILEGERILTAMAY
TILKLHKKRLLKMSLEDLREFLQEKIAGSFSLNDDSVIEQLQASMLELRKMKLDLPPPAK
PEEFPKNPLGQELPVLLVPVKPCQAANDKSKTVPGTVDLRTDREQETVLPDKSPSPLHER
DPKTPNGENVTLPSPSPVMVHSHESGAGPTPQKTEVLPESKYQSTPYLRLRIEFQGERTQ
GEPSEWPPPYEPPETAGDPVALPVQLLEEHLPLPPPPPPLPQAEVPQAEMPCPGIPPKPP
DLAPLRISEDPSCADVDATGFPGSLGVPGHSGERRSSNTSHYDNMEEGAEDPYPHVLPDS
AAALTPPEPPEGSSSLPVPPESNDPMMFPPPPPPVAFFPPKQAALPP
Download sequence
Identical sequences W5M1A3
ENSLOCP00000002160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]