SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5M665 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5M665
Domain Number 1 Region: 1-20,97-206
Classification Level Classification E-value
Superfamily SNARE-like 2.38e-34
Family Sedlin (SEDL) 0.0036
Further Details:      
 
Weak hits

Sequence:  W5M665
Domain Number - Region: 51-83
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000599
Family PDZ domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5M665
Sequence length 219
Comment (tr|W5M665|W5M665_LEPOC) Trafficking protein particle complex 4 {ECO:0000313|Ensembl:ENSLOCP00000003873} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
MAIFSVYVVNKAGGLIYQYDNYVPRAEAEKTFSYPLDLVLKTHDERVIVSFGQRDGIRVG
HAVLSVNGVDVNGRYTADGKEIIEYLKDPSSYPVSIRFGKPRLSSNEKLMLASMFHSLFA
IGSQLSPEVGSSGIEMLETDTFKLHCFQTLTGIKFIVLADPRQSGIDALLRKIYEIYSDY
ALKNPFYSLEMPIRCELFDQNLKSALEVAEKTGTFGPGS
Download sequence
Identical sequences W5M665
XP_006642231.1.81211 ENSLOCP00000003873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]