SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5M6R8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5M6R8
Domain Number 1 Region: 11-114
Classification Level Classification E-value
Superfamily PDZ domain-like 9.46e-20
Family PDZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5M6R8
Sequence length 125
Comment (tr|W5M6R8|W5M6R8_LEPOC) Uncharacterized protein {ECO:0000313|Ensembl:ENSLOCP00000004076} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
MSFIPGQPVTAVVIAESLILHIRRGIYVMIYGISVKSFISSQSEQYILTTEKHKNGIYVT
RVTPGGPAEVAGLMVGDKIMQVNGWDMTMVTHDQARKRLTKKNEDIVRLLVTRKSLEEAV
RHSMM
Download sequence
Identical sequences W5M6R8
ENSLOCP00000004076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]