SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5M828 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5M828
Domain Number 1 Region: 698-826
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-20
Family Pleckstrin-homology domain (PH domain) 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5M828
Sequence length 850
Comment (tr|W5M828|W5M828_LEPOC) Uncharacterized protein {ECO:0000313|Ensembl:ENSLOCP00000004536} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
MAERAGEEEGGVARSPLKRLRDPLSDGEQSRKSEAPEPQEVFKRRCYDVSGDENLNPMEQ
ARSPLKPLHRQVEMVVKPDTPAVASIKSRMNTLAAQRQQDEPSAVSGLEDQSGDQAALET
AVRGDVEFRSRVERFEARTPATEPIAPTSRPHSQSSIARTIQEKLLNSQGSSVSKANRLR
KEREEELRLVRLQSKSDNIWKKNDAEASLMEDAVVKADSQDSERKESDTANCSSAMYVSD
ADLTSQEEELNSSEMIDQIFEGVLDTTEDEVEPDCDDNGMSSREETEEQSGQQVTQEGNV
TTENSNNEQADDEKEKAEVDKHGDNNVDEELTFPPGSILSPLTKSVEAVVTPLRLMSGDA
PGPIPFHLTPSDLTETPPLYSIDAYRSLRQSTLRSYNSVTPTTNRKATEQTRTAQPHSVK
EKIKILNEEISKLQTIIYQTTQALNCCTDEEHGKGSLEEAEAEKLLLVSMEKRLSLLSEL
SRLKEPGASAGSAERGLETSPQEPCRGTLSISDVRLPLKVEFACSARTRAGRPSHYFFVL
IRYGSSNIVATPLATAADAKNGDTIAFPTSITLQDIRPNFEIDVEVYSLSHTTNACNSER
RPSKSKVTPKKLLTNITKSNHNQSSAVLPALGSSVRASNFSLVGSHKITLTSLGQNKFPL
DKIKFDGKVRKLLGDEFQEKVPFLSPLEGNIYLRLACQSHSNIEHRGFLTMFEDISGFGA
WHRRWVCLERGNLSYWNYPNDERSKPAVGCINLTNCTSQCVKPVNRDSCARPNTFELVKL
SQQKDAREILSKCWFSADTKEEREEWMEKLNQALLDHRTWKPVVSDQQTRQRDAPQDMSF
TSTHSRESIL
Download sequence
Identical sequences W5M828
ENSLOCP00000004536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]