SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5M8V9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5M8V9
Domain Number 1 Region: 9-96
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.2e-26
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 
Domain Number 2 Region: 73-173
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.36e-20
Family Ypt/Rab-GAP domain of gyp1p 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5M8V9
Sequence length 418
Comment (tr|W5M8V9|W5M8V9_LEPOC) Si:ch211-266k8.4 {ECO:0000313|Ensembl:ENSLOCP00000004818} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
MGDTPEAIEGQAKLFRVLIAYAKYNPQIGYSQGMSYLAAVLLMHLSEEEAFWALVILLER
PKYLSGLFDHSLHKIQHNAKVFQQLLKHRMPQLSQHIEGLGVSSLHYVMPWFLTLFTSLP
CWDSVLAVWDLLMLHGIAVVFRTGLCIFQLLEPRLLRMPDMSLLLPTLLRVPVDVSRYSA
LVPALWNTEVQEWEIDCMHSLVLEEDREERCPEPVEGAPKSLFAKVLDTARRYLGDTGKE
DDSREMKNLPIHRSPIVPSRSKPCSFSSLRRGQIKRRKKINSSVKDSSQRLQSQGLVTVQ
SQRNTITSSMDLDGEITGDRTPDSSLRRKSSGPANRPLGWRTQTQRVWKKSPKPQLNKAP
LSPLLVHQAPKGSSRISAPEYDSLLEATDTHSREPSPRHSTLSKTKSSLENAQELQLI
Download sequence
Identical sequences W5M8V9
ENSLOCP00000004818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]