SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5M948 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5M948
Domain Number 1 Region: 577-641,943-1062
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0061
Further Details:      
 
Domain Number 2 Region: 15-196
Classification Level Classification E-value
Superfamily RUN domain-like 3.01e-28
Family RUN domain 0.001
Further Details:      
 
Domain Number 3 Region: 1040-1161
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.8e-27
Family Ypt/Rab-GAP domain of gyp1p 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5M948
Sequence length 1169
Comment (tr|W5M948|W5M948_LEPOC) Small G protein signaling modulator 1a {ECO:0000313|Ensembl:ENSLOCP00000004907} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
KDKKCTSKPQTRKSQLEVKQIMEEAVTRKFVHEDSSHIVSFCAAVEACVLHGLKRRAAGF
LRSNKIAALFMKVGKSFPLAEELCRKAQELEQIIENKRNQVPLNHESSRKLQKLPSISPQ
AVKHLWIRTALIEKVLDKIVLYLVENSSKYYEKEAVLMDPVDGPILASLLAVGPCALEYT
KMKTADHFWTDPSADELVQRHRIHSAHCRQDSPTKRPALCIQKRHSSGSMDDRPSMSARD
YVESLHQNSRATLLYGKNNVLVQPRDDMEAIPGYLSLHQTADIMTLKWTPNQLMNGSVGD
LDYEKSVYWDYAMTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPLRFPRGGHLLQFL
SCLENGLLPHGQLDPPLWSQRGKGKVFPKLRKRSPQGSSESVSDKEEDEATDYVFRILFP
GSQSEFDSPTLLTNGKLSSTAVHMEDVYPVQYTGTLCSFMLLGSFTWVLQPYSSLSNDLM
EQAPAMWHPTARKSSCSSCSQSASSDGGPLNGCNHERAPLKLLCDNMKYQIISRAFYGWL
AYCRHLSTVRTHLSALVNHTIVDPDVPQDARGGLTAEIWQKYLQDCTAYEEQELLRLVYF
GGVEPSLRKEVWPFLLGHYQFGMSEKERKEVDDQVRACYEQTMSEWLGCEAIVRQREKEQ
HAVALAKCSSGASLDSQIQKMMHRDSTVSNESSQSCSSDRHSHAQLQSDSSSSTQVFESV
EEVEQIEMEPKGEEAKQATKVPNGVVPNGTCSPDSGHPSSRNFSITSGFSDRSLSTEDSA
GAESTAKTSGQPQPPHPGSAKPAQQVVDPPGVKAPAQGPEEEPREQAAATAEDQGLEEAL
PPVTKARESASAEDSMVAKETSEELLSAIELPLGDDLGTGGVVGPLVLEMQVDEEAEKQS
LVGSEDALSEEPEMESLFPQFDSLAVGGEAKPDATSPVSSIGTTYSQELLDMYTVNLHRI
EKDVQRCDRNYWYFTPTNLEKLRNIMCSYIWQHLEIGYVQGMCDLLAPLLVILDDEAMAF
SCFTELMKRMNQNFPHGGVMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLL
DFKRELVYDDVFSVWETIWAAKYVSSSHFVLFIALALVELYRDIILENNMDFTDIIKFFN
EMAEHHNSKQVLKLARDLVYKVQTLIENK
Download sequence
Identical sequences W5M948
ENSLOCP00000004907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]