SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5MEJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5MEJ0
Domain Number 1 Region: 316-398
Classification Level Classification E-value
Superfamily DEATH domain 2.77e-18
Family DEATH domain, DD 0.00068
Further Details:      
 
Domain Number 2 Region: 74-137
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000785
Family TNF receptor-like 0.012
Further Details:      
 
Domain Number 3 Region: 23-65
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000404
Family TNF receptor-like 0.0016
Further Details:      
 
Weak hits

Sequence:  W5MEJ0
Domain Number - Region: 156-182
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0259
Family TNF receptor-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5MEJ0
Sequence length 408
Comment (tr|W5MEJ0|W5MEJ0_LEPOC) Neurotrophin receptor associated death domain {ECO:0000313|Ensembl:ENSLOCP00000006799} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
YPRGDSLTHTAAVGEEVALGDACASGRFTVTGECCDLCPPGFGVAVECGRENTKCQPCQD
GVSFSVSGSAPCQPCSRCPDGIPKIGGCSAARDTQCDCGDGFYLLGQGNHSTGLCAPCRV
CRKGQGVVQACGPLGDTRCQACGSGSFSEEHSSTEPCRPCRVCLDSEVEIQACLPHSDTL
CMDKNLQILTRPDSDSAQESPRRQAPEGEGDEEGSSPPPGSPKFTPQEEGGNNIIPVYVS
ILSAVVLGLLLYVAYKCWSSCKQKRALAKARGGELSGVPEGEKLHSDSGVFLDTHSLQDN
HPGKGGLRDSKQDSRLYLNLSPQRQEEVETLLQEAGGKGWRHLAAQLEYEQDRIDTFGRG
EDPVHTLLSDWAGQEGSTVAALCSALERIDRSDVAGALSRPAQASSVV
Download sequence
Identical sequences W5MEJ0
ENSLOCP00000006799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]