SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5MGX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5MGX1
Domain Number 1 Region: 23-246
Classification Level Classification E-value
Superfamily Terpenoid synthases 1.81e-57
Family Isoprenyl diphosphate synthases 0.0000000591
Further Details:      
 
Domain Number 2 Region: 743-808
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000105
Family SH3-domain 0.0027
Further Details:      
 
Domain Number 3 Region: 387-571
Classification Level Classification E-value
Superfamily RUN domain-like 0.000000288
Family RUN domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5MGX1
Sequence length 808
Comment (tr|W5MGX1|W5MGX1_LEPOC) RUN and SH3 domain containing 1 {ECO:0000313|Ensembl:ENSLOCP00000007630} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
MGDSVCSSDRKQQGALDAQAFDAQFMDIVRDVTEHDITDPAVTDALHRLRQVMEYNAPGG
KRNRGLSVIGSLRELAAPSELTPEAVQRALVVGWCIEMLQAFFLVADDIMDASLTRRGQA
CWYKKDGVGLDAINDAFLLEGVIYRLLRRHCRGEKYYTQLLELFLETSFQTELGQALDLM
TAQPDLVNLARFTEERYRAIVKYKTAFYSFYLPVAAAMYMAGIDSEEEHSNAKAILLEMG
EFFQIQVRRGRRGDLPKNNSHVLYTNMTQTQYEEDEEDDEDEDDTLVPSCGDCPPSLLDF
SLSSSSSSISSCSDFESDSPNPLSPPDSSLGSLRSPGTLPPQPSPPPAAVRSASFSGSGQ
VGGAWMASSTWTPPGNRGLSLPCLQEKKALVSGVSVAVEAVLSQFSSSRTLVQKAQSGDS
SINPSVGRLVLQCLCPALCRLLSDSLKPYQSDLIAGRRPNSPWGLVQASTRPGTVLPGPC
TQALSSLQRHVDQLPQLRLNSQRFNAFLLGLLNLKLLDFWLSHLQSCEDVLVAHYSPASF
MRLARTSCQPLFEELLLLLQPLALLTFHLDLLFEHHHLDPRTPPSRSPEPAGGADQEGLG
ISPAKGDISQNSSAHQGGGQGNQEHCTAASANQEHKRESPTNQTAGRSGTANQKSKEVPA
DQGSGDVHRSPSKELTGRPGGVGADTPRIWLGRLFGASKGHMDTSASDLKATHNPLRRPS
SWLVPGVSVLTRMASPAQSAPPEGEQDRPRPRTPRYTALLDRSVRTLCDHQGTGAELSFK
KGEELLLIGGVDEEWIRCRQGDREGLVP
Download sequence
Identical sequences W5MGX1
ENSLOCP00000007630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]