SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5MHJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5MHJ5
Domain Number 1 Region: 63-217,245-264
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.97e-33
Family Ypt/Rab-GAP domain of gyp1p 0.0027
Further Details:      
 
Domain Number 2 Region: 301-411
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.19e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5MHJ5
Sequence length 828
Comment (tr|W5MHJ5|W5MHJ5_LEPOC) TBC1 domain family, member 5 {ECO:0000313|Ensembl:ENSLOCP00000007854} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
MQHPNFETRHPLQSDDQERGIDPLQKYNRSKGGSAESSGTITFSESDSTFISYRKEWDEL
FLNCNYLARIRQKGINGQLRSSRFRSVCWKLYLDVLPEDKSQWINKTKELRAQYEKIKET
HITNPRKAAGQQDLVVNNPLSQDEGSLWNKFFQDKELRGMIQQDVMRTFPEMQYFQQDAV
RNMLTDILFCYARENEQLLYKQGMHELLAPIVFILHCDHQAFQHASETAYPSEEMKSLLN
PAFHEHDAYAMFSQLMETAEPWFSTFERQVRKGKEEMITSIPFARPQDTGPSVAVVTKVN
RIQDQLIKKHDIELYMHLNRLEIAPQIYGIRWVRLLFGREFPLQDLLVVWDALFADSITL
DLVDYIFVAMLLYIRDALIASNYQTCLGLLMHYPPIGDIHALLQKALFLRDPKNNPRPVN
YQFQQNLDYYKTRGADLMSKTRASAKAAPLNINKVSSSLLSFGRKLIAPAISVSASTVSP
INSDVSTVAAPTVTRSMVESSQIQQQPQQQAQHHRLLKSESMPVHLSKDVVTGGGAQVSI
PVQTVTDIQGQSSKNVSSSPSIESLPGGRDHTASPPLSATKKDSFFNISRSRSHSKTMGK
KDSEEDLEAQISFLQGQLNDLEAMCKYCAKMMNLHIGKIQEVILQENLEKEDEVLVSLAG
LKQIKDILKGSLRFNQSQLEAEENEEITIADDHYCSSTQKGGERNGHKGTNRERPFSLRS
QQATSESSLNSEGRNSDDYILISQDDDVEQDPEEKKDITASTAKVPSFPKGVKVTPKPEK
EAPPSAVFQDPLMTMASASGSTSGSSPDDDSSNSKDCDFTIVNPMDLS
Download sequence
Identical sequences W5MHJ5
ENSLOCP00000007854 XP_015212980.1.81211 XP_015212981.1.81211 XP_015212982.1.81211 XP_015212983.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]