SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5MIY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5MIY3
Domain Number 1 Region: 457-592
Classification Level Classification E-value
Superfamily TIMP-like 7.69e-25
Family Netrin-like domain (NTR/C345C module) 0.025
Further Details:      
 
Domain Number 2 Region: 234-329
Classification Level Classification E-value
Superfamily Immunoglobulin 9.82e-21
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 410-463
Classification Level Classification E-value
Superfamily BPTI-like 2.84e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0024
Further Details:      
 
Domain Number 4 Region: 347-404
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000922
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.014
Further Details:      
 
Domain Number 5 Region: 151-201
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000222
Family Ovomucoid domain III-like 0.038
Further Details:      
 
Domain Number 6 Region: 62-110
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000628
Family Elafin-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5MIY3
Sequence length 598
Comment (tr|W5MIY3|W5MIY3_LEPOC) WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1 {ECO:0000313|Ensembl:ENSLOCP00000008342} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
MSRTDHSRRETRSRTSACERRSDAGGCVPRLGKLAPSFPLLWALACALSPPVSGASLAGG
QTQHPGVCPNQLNANLWVDAQSTCERECRVDQDCAGFEKCCTNVCGLRSCVAARFSDGSA
APSDGQGPRESGGGVTASCQGFVCSQQGATCDVWEGQPVCKCRDRCEKEPSFTCASDGLT
YFNRCYMDAEACIRGVALTVVTCRYHLAWPHTSPLPLDTTAHPTPTSSREEPLPPTLYSN
PSHQSVYLGGTVSFHCDVVGVPRPDITWEKQTERRESLIMRPDQMYGNLVITNIGQLVIY
NARPGDTGIYTCTARNSAGILRADYPLSVIRRAEDELAEEGEPAPRPFSPADCLEEADRR
ECGDRRVGWRYDAKRGSCLALAHGGCEGARNRFETYEECRASCQREGVGVCSLPAVQGPC
KVWEARWAYNPLMKQCQAFAYGGCQGNGNSFRSREECEESCPQPKSRPCRACKPKGKMVP
SLCRSDFAVVGRLTELIEELDSGIARFSLEEVLRDEKMGLAFFDARHLEVTLARVDWSCP
CPNVTLEDGPLLVMGEVQDGMALLQPDSYVRPVTERRLKKIREVLEKRTCELLQRFQD
Download sequence
Identical sequences W5MIY3
ENSLOCP00000008342 XP_006637369.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]