SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5MNQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5MNQ1
Domain Number 1 Region: 52-194
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000002
Family Phosphotyrosine-binding domain (PTB) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5MNQ1
Sequence length 217
Comment (tr|W5MNQ1|W5MNQ1_LEPOC) Phosphotyrosine interaction domain containing 1 {ECO:0000313|Ensembl:ENSLOCP00000010010} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
IWSREEEPPKHFQTMLKTKLNVLTLKKEPLPTVIFHEPEAIELCSTTPLMKNRTHTGYKV
TYLGKVTIRGTQFLSGCTEPAVIGLWERRATAQEDTRPANAVLEIRPFQVRLHHLDGRGE
ATVHMDTYQVARIAYCTADHHVSPNIFAWIYREINDDLTFQMDCHAVECENKLEAKKLAH
AMMEAFRKTFNSMKNDGRIHKSSSSDEFPQEFAADDG
Download sequence
Identical sequences W5MNQ1
ENSLOCP00000010010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]