SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5MNS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5MNS2
Domain Number 1 Region: 77-252
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.15e-42
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 
Domain Number 2 Region: 227-348
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.02e-30
Family Ypt/Rab-GAP domain of gyp1p 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5MNS2
Sequence length 481
Comment (tr|W5MNS2|W5MNS2_LEPOC) TBC1 domain family, member 10Aa {ECO:0000313|Ensembl:ENSLOCP00000010031} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
MAKTENGLRSSDPQNLRGTSESLAERESSSFGSDSEVNGFANTERQTDRYGFIGGAQQHT
GHSEQEVPPEVLRQREAKWLDMLNNWDKWMAKRHKKVKLRCQKGIPPSLRGRAWLYLSGG
KVKKEQNQRKFQELDSQPGDPKWLDVIEKDLHRQFPFHEMFVARGGHGQQDLFRVLKAYT
LYRPEEGYCQAQAPIAAVLLMHMPAEDAFWGLVQICEKYLPGYYSAGLEAIQLDGEILFA
LLRRVSPAAHKHLKKHKIDPILYMTEWFMCAFSRTLPWASVLRVWDMFFCEGVKIIFRVG
LVLLKCMLGTQEKLKACQGQYETMELLRAVDPKYMLEGFLIREILELPVSERDIEKEHHV
QLKRWKETHGDLHYKSPPRMHGARAIITAEPHTRQDLRQNPTIVVEPPPPNAPPAKDEKK
KDKGRRGSLKKAPGSKKEVANPYPIPSVPPSLPADAPLQPEPESSQQDNQSLSSTELDTY
L
Download sequence
Identical sequences W5MNS2
XP_006640524.1.81211 ENSLOCP00000010031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]