SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5MQR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5MQR4
Domain Number 1 Region: 548-593
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000981
Family TSP-1 type 1 repeat 0.00093
Further Details:      
 
Domain Number 2 Region: 54-101
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000405
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 107-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000694
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 503-542
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000789
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5MQR4
Sequence length 593
Comment (tr|W5MQR4|W5MQR4_LEPOC) Complement component 8, alpha polypeptide {ECO:0000313|Ensembl:ENSLOCP00000010723} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
MKRFIHSSVGLTLLILLNHLIVVRPSNTLRSCVDGRGKNSTARKPRGVNTPAPVDCKLGP
WSAWAPCSACQQKTYQHRYLEQANQFGGNPCLGNKLEEKICPSDIQCNRQDLCGEDFTCQ
ETGRCISRRLLCNSDPDCRDGSDENECGDLENYEDTFCKQLFPIPGSEISARGYNALTGE
FLLNTIDPGYYGGFCEYVYNGDWRELTYNAFCEHMSYNEDEKYYRKPYNIHYYQFLAQAD
SGSSSEFYNDVTSLLRAKKEEDSFNFGFTIGISVVEGGFSHKQDSKSLKNISEYTDQNLG
FIRHLTKIQTSQFKMRSRGLVLDEDMYQSLIELPEEYDYGAYSQFINSYGTHYITSGIMG
GILEYIMVVDKKSMERNEITGEQAGQCNALSLGIAKVGPMDLSVSADFCNRHGFQNTDNK
KESSMVKDVINLIRGGDTASSGGLLAVYDEKTYRHWGKSLKYQPALIEFEILPIYELVHF
STAKSGNAKLENLRKAWHEYLREFNSCRCQPCKNNGQTMLDGTSCRCLCPSGFEGPACEE
TQRKGPTHGNWGCWSSWSFCRSGSKTRSRHCNNPAPLNDGSPCLGKASQTVSC
Download sequence
Identical sequences W5MQR4
XP_015211300.1.81211 ENSLOCP00000010723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]