SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5MQT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5MQT1
Domain Number 1 Region: 542-588
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000889
Family TSP-1 type 1 repeat 0.00089
Further Details:      
 
Domain Number 2 Region: 121-161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000707
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 3 Region: 59-106
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000379
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 4 Region: 498-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000652
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5MQT1
Sequence length 589
Comment (tr|W5MQT1|W5MQT1_LEPOC) Complement component 8, beta polypeptide {ECO:0000313|Ensembl:ENSLOCP00000010740} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
MTPLSVIHIFSKNPSFLLFVLLHVTRCCSEVQLSLHNSSLNVLSKVRWSRSVGGLPEPVE
CVFSEWSEWTRCDPCQKKRYRYTKLQQPSQFGGEPCHFRGREEEACAPPSRYSCRDSVQC
DGFVCTTTGRCIPQRLVCNGDDDCGDRSDEKSCKKVYKPCKTKVEEYWGIENLGKGINIL
NSNLEGVVIDNRYYGGSCLPQYIYNTRFRKPFNLQHYTLETKGNYEFSLDAYESYSSYEK
DTFKAHSSQKSVSFGISLPGIFEFGFNYQDAKFKKNVQKTRRLSGTKSSFVRAHSRLEVA
QYKLKTQDLMLHYEFFQRLQSLPVEYSYGEYKEIFKDYGTHYITEATLGGDYEYTVVLNQ
ESMERTDFTLSDANKCVQAGLKVGANIDGLYVSLGAGGGRCRGLLKELGDSKTEKRFVED
FIVEVKGGASEYITRLAYNQLPTPALMQEWGEAVQYNPDFIESKTEPLFELVTSKDFANA
NIIKRNLKRALEEYLAESSNCRCAPCLNNGVAVLKDTRCECVCPMGFRGRACEITQRTGV
AVDGSWSCWSQWSTCSGQKRRRSRSCTNPPPQNGGVGCFGISEESETCK
Download sequence
Identical sequences W5MQT1
ENSLOCP00000010740 XP_015211299.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]