SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5MQU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5MQU2
Domain Number 1 Region: 546-592
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000889
Family TSP-1 type 1 repeat 0.00089
Further Details:      
 
Domain Number 2 Region: 125-165
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000072
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 3 Region: 63-110
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000379
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 4 Region: 502-540
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000069
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5MQU2
Sequence length 593
Comment (tr|W5MQU2|W5MQU2_LEPOC) Complement component 8, beta polypeptide {ECO:0000313|Ensembl:ENSLOCP00000010751} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
LLTIYNLLFKLCNTISLLCACFIICLSFVNSCSEVQLSLHNSSLNVLSKVRWSRSVGGLP
EPVECVFSEWSEWTRCDPCQKKRYRYTKLQQPSQFGGEPCHFRGREEEACAPPSRYSCRD
SVQCDGFVCTTTGRCIPQRLVCNGDDDCGDRSDEKSCKKVYKPCKTKVEEYWGIENLGKG
INILNSNLEGVVIDNRYYGGSCLPQYIYNTRFRKPFNLQHYTLETKGNYEFSLDAYESYS
SYEKDTFKAHSSQKSVSFGISLPGIFEFGFNYQDAKFKKNVQKTRRLSGTKSSFVRAHSR
LEVAQYKLKTQDLMLHYEFFQRLQSLPVEYSYGEYKEIFKDYGTHYITEATLGGDYEYTV
VLNQESMERTDFTLSDANKCVQAGLKVGANIDGLYVSLGAGGGRCRGLLKELGDSKTEKR
FVEDFIVEVKGGASEYITRLAYNQLPTPALMQEWGEAVQYNPDFIESKTEPLFELVTSKD
FANANIIKRNLKRALEEYLAESSNCRCAPCLNNGVAVLKDTRCECVCPMGFRGRACEITQ
RTGVAVDGSWSCWSQWSTCSGQKRRRSRSCTNPPPQNGGVGCFGISEESETCK
Download sequence
Identical sequences W5MQU2
ENSLOCP00000010751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]