SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5MWE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5MWE7
Domain Number 1 Region: 9-89
Classification Level Classification E-value
Superfamily PDZ domain-like 1.18e-22
Family PDZ domain 0.00054
Further Details:      
 
Domain Number 2 Region: 282-311
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000131
Family LIM domain 0.0024
Further Details:      
 
Domain Number 3 Region: 253-281
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000175
Family LIM domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5MWE7
Sequence length 332
Comment (tr|W5MWE7|W5MWE7_LEPOC) PDZ and LIM domain 4 {ECO:0000313|Ensembl:ENSLOCP00000012706} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
MPQTVTLIGPSPWGFRLVGGRDFSTPLTISRITPGSKAAQAELNPGDTIVAINGDSTESM
THMEAQNRIKACTDQLVLSISRSETKIWSPTGTEDGKTNPFKVNLEAEPQGFRPIGSGYN
RRAAQYVTDVPLNNGNSKSALQYNNPVGLYNNNNTEATLPKQMTNLRLGSSNSPEPQIHS
PSSKNGFDTQSEVYKMLQDYEEPSAEPKQSGSFRYLQGILQAEDSAERPAVKSVKSPVRS
PVPKLGSPLPGFQLPECTRCGNGIVGTIVKARDKLYHPECFMCDDCGLNLKQRGYFFIED
HLYCETHAKARVQPPEGYDVVAVYPNSKVELV
Download sequence
Identical sequences W5MWE7
ENSLOCP00000012706 XP_006631855.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]