SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5N031 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5N031
Domain Number 1 Region: 103-137
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 2 Region: 45-94
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000615
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 3 Region: 552-594
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000405
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 4 Region: 500-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000733
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5N031
Sequence length 594
Comment (tr|W5N031|W5N031_LEPOC) Complement component 9 {ECO:0000313|Ensembl:ENSLOCP00000013990} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
MKTLAVLSVILCLLQGIILVDGGDFMDNSKPLQRMAREVGAPAQVDCKLSTWSPWSKCDP
CSKQMFRARSVEVFGQFGGQTCFEPLGQKKACTTDDACDRVQPECSETEFRCESGTCIKK
RLECNGDNDCGDLSDEDCEEPHRPPCGKSLVDLSELGRTAGYGINILGSHPRANPFNNEF
FNGVCNRVRDPSTREYNRIPWNVVALTYATLTEESFSKDIFEEASTLVRELLTEKSISVD
AGFSFKFSGSPKEEGAASDTGGGFKGGVNVDSSEKIKTINEYSTVKTKSFMRVKGKIQLS
TFRMRSRDLRLSDTFLDDLIDLPLEYSKSRYFDFLEDYGTHYTVSGTAGGKYDLVYVMDK
ETLKTSRMKEEEIKKCLGFDASVDFKTSGVDLDLHAKPKFCNNLKTGSTATNESTALLEK
VISFVSGGTPASTAALKRQIEKEGVMDVNAYVEWARSLDVAPVLVTSKPEAIYNLVPLTM
TDANKKKANLEAAINDYIEEYNVCKCKPCQNGGTVTLIDGDCLCLCLPKFEGIAYQNRKS
EAIDSGTVVQEGNWACWSSWSACAGGHRTRSRICNTEGLSKGSCKGEQVKTDYC
Download sequence
Identical sequences W5N031
XP_015194299.1.81211 ENSLOCP00000013990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]