SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5N0V3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5N0V3
Domain Number 1 Region: 68-231
Classification Level Classification E-value
Superfamily RUN domain-like 2.35e-52
Family RUN domain 0.0000000443
Further Details:      
 
Domain Number 2 Region: 526-621
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000148
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.017
Further Details:      
 
Weak hits

Sequence:  W5N0V3
Domain Number - Region: 261-364
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00152
Family Myosin rod fragments 0.011
Further Details:      
 
Domain Number - Region: 434-543
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0956
Family Calponin-homology domain, CH-domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5N0V3
Sequence length 630
Comment (tr|W5N0V3|W5N0V3_LEPOC) RUN and FYVE domain containing 3 {ECO:0000313|Ensembl:ENSLOCP00000014262} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence
MSDLTPQSDAPTPTTDKITQAARETIYLCNFRVSVDGEWLCLRELNDISLTPDPEPAHED
PKDPIAIERLNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKTKK
TFLGQNKSFWGPLELVEKLTPEAGEITASVKDLPGLKTPIGRGRAWLRLALMQKKLSDYM
KTLINRKDLLSEFYEPNALMMEEEGAVIAGLLVGLNVIDANLCMKGEDLDSQVGVIDFSM
YLKDGGHSSKSTEGDGQITAILDQKNYVEELNRHLSASVNNLQAKVDALEKSNTKLTEEL
AVANNRIITMQEEVERVKEESSYLLESNRKVSKVDGSADGQVLGETRKQLKEETQLRLDV
EKELEVQIGMKQEMELSMKMLEKDICEKQDALVALRQQLDDLRTLNHELSHKSQSSDTAL
KQKSDIISRLEEKANQMAGTIKVLEQRSRQAERERDLAEEANRLFKKEFGDKIESLQLEI
EQLRKQRSVLELEKRERERKTGLHIESVAVDIKASPPVKNYKQQMKDIKRELQAVKEENV
KLRTVLDGKESLNSSLLFQDQSSTKNSQPSLCRLCKEEDSLARKQCNNCREDFCENCLAN
ELPLPSSINPVQVCTVCHKKLLKQYSSSPV
Download sequence
Identical sequences W5N0V3
ENSLOCP00000014262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]